SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019884 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019884
Domain Number 1 Region: 13-141
Classification Level Classification E-value
Superfamily ENTH/VHS domain 1.19e-29
Family RPR domain (SMART 00582 ) 0.0071
Further Details:      
 
Domain Number 2 Region: 420-549
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.63e-18
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019884   Gene: ENSMMUG00000015163   Transcript: ENSMMUT00000021263
Sequence length 1271
Comment pep:known chromosome:MMUL_1:4:108138728:108200639:-1 gene:ENSMMUG00000015163 transcript:ENSMMUT00000021263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LYVNLFFFHQLYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFIQKCKPEYKV
PGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIVRVLNLWQKN
NVFKSEIIQPLLDMAAGIPPPVVTPVLASTTTAMSNTPGTPVTPVTPANVVQGLPDPWVS
QITNTDTLAAVAQILQSPQGQQLQQLIQTLQIQQQKPQPSILQALDAGLVVQLQALTAQL
TAAAAAANTLTPLEQGVSFNKKLMDRFDFGEDSEHSEEPKKEIPTSQLSHVSESVNNSIF
HQIAEQLQQQNLEHLRQQLLEQQRPFNATPQDSQEGTFGSEHSASPSQGSSQQHFLEPEV
NLDDSIDIQQQDMDIDEGQDGVEEEVFEQEAKKVAVRSRSRTHSRSRSRSPRKRRSRSRS
GSRKRKHRKRSRSRSRERKRKSSRSYSSERRAREREKERQKKGLPPIRSKTLSVCSTTLW
VGQVDKKATQQDLTNLFEEFGQIESINMIPPRGCAYVCMVHRQDAFRALQKLSSGSYKIG
SKVIKIAWALNKGVKTEYKQFWDVDLGVTYIPWEKVKVDDLEGFAEGGMIDQETVNTEWE
TVKSSEPVKETVQTTQSPTPVEKETVVTTQAEVFPPPVAMLQIPVAPAVPTVSLVPPAFP
VSMPVPPPGFSPIPPPPFLRASFNPSQPPPGFMPPPVPPPVVPPPAIPPVVPTSLVQPSL
SMTPETVKDVGFGSLVIPGGSVASNLATSALPAGNVFNAPTKQAEPEEKVPHLIDHQISS
GENTRSVIPNDISSNAAILGGQPPNVTSNSGILGVQRPNVSSNSEILGVRPSNVSSSSGI
IGAQPPNILNNSGILGIQPPSVSSGSGLLGVLPPNIPNNSGLVGVQPPNVPNTSGLLGTQ
PPAGPQNLPPLSIPNQRMPTMPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDS
ALHPPPRGPFPPGDIFSQPERPFLAPGRQSIDNVANPEKRIPLGNDNIQQEGDRDYRFPP
IETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDIRENLVRPGIDHLG
RRDHFGFNPEKPWGHRGDFDEREHRVLPVYGGPKGLHEERGRFRSGNYRFDPRSGPWNRG
FGQEVHRDFDDRRRPWERQRDRDDRDFDFCREMNGNRLGRDRIQNTWVPPPHARVFDYFE
GATSQRKGDNVPQVNGENTERHAQPPPIPVQNDPELYEKLTSSNEINKEKSDTVADIESE
PVVESTETEGT
Download sequence
Identical sequences ENSMMUP00000019884 9544.ENSMMUP00000019884 ENSMMUP00000019884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]