SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019885 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019885
Domain Number 1 Region: 341-725
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 4.53e-81
Family Regulator of chromosome condensation RCC1 0.00023
Further Details:      
 
Domain Number 2 Region: 51-351
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.55e-80
Family Protein kinases, catalytic subunit 0.0000056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019885   Gene: ENSMMUG00000015166   Transcript: ENSMMUT00000021264
Sequence length 979
Comment pep:known chromosome:MMUL_1:7:138194212:138238743:-1 gene:ENSMMUG00000015166 transcript:ENSMMUT00000021264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVLGEYERHCDSINSDFGSESGGCGDSSPGPSASQGPRAGGGAAEQEELHYIPIRVLGR
GAFGEATLYRRTEDDSLVVWKEVDLTRLSEKERRDALNEIVILALLQHDNIIAYYNHFMD
NTTLLIELEYCNGGNLYDKILRQKDKLFEEEMVVWYLFQIVSAVSCIHKAGILHRDIKTL
NIFLTKANLIKLGDYGLAKKLNSEYSMAETLVGTPYYMSPELCQGVKYNFKSDIWAVGCV
IFELLTLKRTFDATNPLNLCVKIVQGIRAMEVDSSQYSLELIQMVHSCLDQDPEQRPTAD
ELLDRPLLRKRRREMEEKVTLLNAPTKRPRSSTVTEAPIAVVTSRTSEVYVWGGGKSTPQ
KLDVIKSGCSARQVCAGNTHFAVVTVEKELYTWVNMQGGTKLHGQLGHGDKASYRQPKHV
EKLQGKAIHQVSCGDDFTVCVTDEGQLYAFGSDYYGCMGVDKVAGPEVLEPMQLNFFLSN
PVEQVSCGDNHVVVLTRNKEVYSWGCGEYGRLGLDSEEDYYTPQKVDVPKALIIVAVQCG
CDGTFLLTQSGKVLACGLNEFNKLGLNQCMSGIINHEAYHEVPYTTSFTLAKQLSFYKIR
TIAPGKTHTAAIDERGRLLTFGCNKCGQLGVGNYKKRLGINLLGGPLGGKQVIRVSCGDE
FTIAATDDNHIFAWGNGGNGRLAMTPTERPHGSDICTSWPRPIFGSLHHVPDLSCRGWHT
ILIVEKVLNSKTIRSNSSGLSIGTVFQSSSPGGGGGGGSGEEEDSQQESETLDPSGGFRG
TMEADRGMEGLISPTEAMGNSNGASSSCPGWLRKELENAEFIPMPDSPSPLSAAFSESEK
DTLPYEELQGLKVASEAPLEHKPQVGAWSPRLNPAVTCAGKGTPLTPPACACSSLQVEVE
RLQGLVLKCLAEQQKLQQENLQIFTQLQKLNKKLEGGQQVGMHSKGTQTAKEEMEMDPKP
DLDSDSWCLLGTDSCRPSL
Download sequence
Identical sequences A0A2K5U5Y8 A0A2K6D0N3 F6U7G5
NP_001252560.1.72884 XP_005561872.1.63531 XP_011763853.1.29376 9544.ENSMMUP00000019885 ENSMMUP00000019885 ENSMMUP00000019885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]