SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019897 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019897
Domain Number 1 Region: 432-649
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000137
Family GUN4-associated domain 0.057
Further Details:      
 
Domain Number 2 Region: 5-152
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00000283
Family APC10-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019897   Gene: ENSMMUG00000015173   Transcript: ENSMMUT00000021276
Sequence length 925
Comment pep:known chromosome:MMUL_1:1:6784314:6827334:-1 gene:ENSMMUG00000015173 transcript:ENSMMUT00000021276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHKIGFVVVSSSGHEDGFSARELMIHAPTVSGWRSPRFCQFPQEIVLQMVERCRIRKLQ
LLAHQYMISSKIEFYISESLPEYFAPYQAERFRRLGYVSLCDNEKTGCKARELKSVYVDA
VGQFLKLIFHQNHANKYNIYNQVALVAINIIGDPADFSDESNTASREKLIDHYLGHNSED
PALEGTYTRRSDYISPLDDLAFDMYQDPEVAQIIRKLDERKREAVQKERYDYAKKLKQAI
ADLQKVGERLGRYEVEKRCAVEKEDYDLAKEKKQQMEQYRAEVYEQLELHSLLDAELMRR
PLDLPLRPLARSGSPRHQKPMPSLPQLEERGTENQFAEPFLQEKPSSYSLTVSPQHSAVD
QLLPATDPHPKINAESLPYDERPLPAIRKHHGEAVVEPEMSDADISDARRGGLSGEPEPL
TEKALREASSAIDVLGETLVAGAYSKTWSYREDALLALYKKLMEMPVGTPKEDLKNTLRA
SIFLIRRAIKDIVTSVFQASLKLLKMIITQYIPKHKLSKLETAHCVERTIPVLLTRTGDS
SARLRVTAANFIQEMALFKEVKSLQIIPSYLVQPLKTNSSVHLAMSQMGLLARLLKDLGT
GSSGFTIDNVMKFSVSSLEHRVYEVRETAVRIILDMYRQHQASILEYLPPDDSNTRKNIL
YKTIFEGFAKIDGRPTDAEMRARRKAATEEAEKQKKEEIKALQGQLAALKDIQAEVQEKE
SDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSESFTEEGLDLHYWKHCLML
TRCDHCKQVVEISSLTEHLLTECDKKDGFGKCYRCSEAVFKEELPRHIKNKECNPAKPEK
LANRCPLCHENFSPGEEAWKAHLMGPAGCTMNLRKTHILQKAPALQPGKSSAVAASGPSG
SKAGSKIPTPKGGLSKSSSRTHARR
Download sequence
Identical sequences A0A2K5WWD7 F6U796
ENSMMUP00000019897 ENSMMUP00000019897 9544.ENSMMUP00000019897 XP_005545021.1.63531 XP_005545022.1.63531 XP_014994461.1.72884 XP_014994518.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]