SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019905 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019905
Domain Number 1 Region: 309-564
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.84e-81
Family Biotin dependent carboxylase carboxyltransferase domain 0.000016
Further Details:      
 
Domain Number 2 Region: 48-296
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.26e-60
Family Biotin dependent carboxylase carboxyltransferase domain 0.0000621
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019905   Gene: ENSMMUG00000015175   Transcript: ENSMMUT00000021284
Sequence length 564
Comment pep:known chromosome:MMUL_1:6:67745186:67810927:1 gene:ENSMMUG00000015175 transcript:ENSMMUT00000021284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAALRLILRPCARASPAGLRAYHGDSVASLGTQPDVGSALYQENYEQMKALVNQLHERV
EHIKLGGGEKARALHISRGKLLPRERIDDLIDPGSPFLELSQFAGYQLYDNEEVPGGGII
TGIGRVSGVECMIIANDATVKGGTYYPVTVKKQLRAQEIAMQNRLPCIYLENSGGKYLLS
SRKDSFPKVSHITFHFYNLVIVYFKNAFQIAVVMGSCTAGGAYVPAMADENIIVRKQGTI
FLGGPPLVKAATGEEVSAEDLGGADLHCRKSGVGDHYALDDHHALHLTRKVVRNLNYQKK
LDVTIEPSEEPLFPADELYGIVGANLKRNFDVREVIARIVDGSRFTEFKAFYGDTLVTGF
ARIFGYPVGIIGNNGVLFSESAKKGTHFIQVCCQRNIPLLFLQNVTGFMVGREYEAEGIT
KDGAKMVTAVACAQVPKITLIIGGSYGAGNYGMCGRAYSPRFLYIWPNARISVMGGEQAA
NVLATIAKDQRAREGKQFSSADEAALKEPIIKKFEEEGNPYYSSARVWDDGIIDPADTRL
VLGLSFSAALNAPIEKTDFGIFRM
Download sequence
Identical sequences 9544.ENSMMUP00000019905 ENSMMUP00000019905 ENSMMUP00000019905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]