SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019914 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019914
Domain Number 1 Region: 599-879
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.73e-56
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 50-253
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 5.49e-17
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019914   Gene: ENSMMUG00000015185   Transcript: ENSMMUT00000021295
Sequence length 1005
Comment pep:known chromosome:MMUL_1:16:59594657:59681938:-1 gene:ENSMMUG00000015185 transcript:ENSMMUT00000021295 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAASLSSRRPRPVLCPYRPRSQGRVLAMPARRLLLLLLTLLLPGLGIFGSTSTVTLPETL
LFVSTLDGSLHAVSKRTGSIKWTLKEDPVLQVPTHVEEPAFLPDPNDGSLYTLGSKNNEG
LTKLPFTIPELVQASPCRSSDGILYMGKKQDIWYVIDLLTGEKQQTLSSAFADSLCPSTS
LLYLGRTEYTITMYDTKTRELRWNATYFDYAASLPEDDMDYKMSHFVSNGDGLVVTVDSE
SGDVLWIQNYASPVVAFYVWQREGLRKVMHINVAVETLRYLTFMSGEVGRITKWKYPFPK
ETEAKSKLTPTLYVGKYSTSLYASPSMVHEGVAVVPRGSTLPLLEGPQTDGVTIGDKGEC
VITPSTELKFDSGLKSKNKLNYLRNYWLLIGHHETPLSASTKMLERFPNNLPKHRENVIP
ADSEKKSFEEVINLVDQTSENAPTTVSRDVEEKPAHAPARPEAPVDSMLKDVATIILSTF
LLIGWVAFIITYPLSMHQQQQLQHQQFQKELEKIQLLQQQQQQLPFHPPGDTAQDGELLD
TSGPYSESSGTSSPNTSPRASNHSLCSGSSASKAGSSPSLEQDDGDEETSMVIVGKISFC
PKDVLGHGAEGTIVYRGMFDNRDVAVKRILPECFSFADREVQLLRESDEHPNVIRYFCTE
KDRQFQYIAIELCAATLQEYVEQKDFAHLGLEPITLLQQTTSGLAHLHSLNIVHRDLKPH
NILISMPNAHGKIKAMISDFGLCKKLAAGRHSFSRRSGVPGTEGWIAPEMLSEDCKENPT
YTVDIFSAGCVFYYVISEGSHPFGKSLQRQANILLGACSLECLHPEKHEDVIARELIEKM
IAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQDVSDRIEKESLDGPIVKQLERGGRAVVKM
DWRENITVPLQTDLRKFRTYKGGSVRDLLRAMRNKKHHYRELPAEVRETLGSLPDDFVCY
FTSRFPHLLAHTYRAMELCSHERLFQPYYFHRPPEPQPPVTPDAL
Download sequence
Identical sequences ENSMMUP00000019914 ENSMMUP00000019914 9544.ENSMMUP00000019914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]