SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019990 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000019990
Domain Number - Region: 139-218,301-306,432-537
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000746
Family Quinoprotein alcohol dehydrogenase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019990   Gene: ENSMMUG00000015249   Transcript: ENSMMUT00000021376
Sequence length 550
Comment pep:known chromosome:MMUL_1:14:110644223:110684595:1 gene:ENSMMUG00000015249 transcript:ENSMMUT00000021376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFKRYMGNAHQKKAIFGQCRGLPCVAPLLTTVEEAPRGISARVWGHFPKWLNGSLLRIGP
GKFEFGKDKYNHWFDGMALLHQFRMAKGTVTYRSKFLQSDTYKANSAKNRIVMSEFGTLA
IPDPCKNVFERFMSRFELPGKAAAMTDNTNVNYVRYKGDYYLCTETNFMNKVDIETLEKT
EKVDWSKFIAVNGATAHPHYDPDGTAYNMGNSFGPFGFSYKVIRVPPEKVDLEETIHGAQ
VICSIAPTEKGKPSYYHSFGMTRNYIIFIEQPLKMNLWKIATSKIRGKAFSDGISWEPQC
NTRFHVVDKHTGQLLPGRYYSKPFVAFHHINAFEDQGCVIIDLCCQDNGRILEVYQLQNL
RKAGEELDQVYNSAGRSFPRRFVLPLNVSLNAPEGDNLSPLSYTSASAVKQADGTIWCSH
ENLHQEDLEKEGGIEFPQIYYGQFSGKKYRFFYGCGFRHLVGDSLIKVDVVNKTLKVWRE
DGFYPSEPVFVPVPGTNEEDGGVILSVVITPNQNESNFLLVLDAKNFEELGRAEVPVQMP
YGFHGTFIPI
Download sequence
Identical sequences ENSMMUP00000019990 ENSMMUP00000019990 9544.ENSMMUP00000019990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]