SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020041 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020041
Domain Number 1 Region: 610-920
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.69e-69
Family Tandem AAA-ATPase domain 0.0000375
Further Details:      
 
Domain Number 2 Region: 357-608
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.5e-61
Family Tandem AAA-ATPase domain 0.0000438
Further Details:      
 
Domain Number 3 Region: 1024-1172
Classification Level Classification E-value
Superfamily Bromodomain 9.03e-31
Family Bromodomain 0.0012
Further Details:      
 
Domain Number 4 Region: 238-315
Classification Level Classification E-value
Superfamily BRK domain-like 4.45e-22
Family BRK domain-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020041   Gene: ENSMMUG00000015279   Transcript: ENSMMUT00000021427
Sequence length 1249
Comment pep:known chromosome:MMUL_1:15:75042928:75077673:-1 gene:ENSMMUG00000015279 transcript:ENSMMUT00000021427 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILQEREYRLQARIAHRIQELENLPGSLPPDLRTKATVELKALRLLNFQRQLRQEVVACMR
RDTTLETALNSKAYKRSKRQTLREARMTEKLEKQQKIEQERKRRQKHQEYLNSILQHAKD
FKEYHRSVAGKIQKLSKAVATWHANTEREQKKETERIEKERMRRLMAEDEEGYRKLIDQK
KDRRLAYLLQQTDEYVANLTNLVWEHKQAQAAKEKKKRRRRKKKAEENAEGGESALGPDG
EPIDESSQMSDLPVKVTHTETGKVLFGPEAPKASQLDAWLEMNPGYEVAPRSDSEESDSD
YEEEDEEEESSRQETEEKILLDPNSEEVSEKDAKQIIETAKQDVDDEYSMQYSARGSQSF
YTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIA
LITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSG
KFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTG
TPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKV
LRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGG
AKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPK
LRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFI
FLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVE
EKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAFLQAILEHEEENEEEDEVPDDETLNQ
MIARREEEFDLFMRMDMDRRREDARNPKRKPRLMEEDELPSWIIKDDAEVERLTCEEEEE
KIFGRGSRQRRDVDYSDALTEKQWLRAIEDGNLEEMEEEVRLKKRKRRRNVDKDPAKEDV
EKAKKRRGRPPAEKLSPNPPKLTKQMNAIIDTVINYKDRCNVEKVPSNSQLEIEGNSSGR
QLSEVFIQLPSRKELPEYYELIRKPVDFKKIKERIRNHKYRSLGDLEKDVMLLCHNAQTF
NLEGSQIYEDSIVLQSVFKSARQKIAKEEESEDESNEEEEEEEEEESESEAKSVKVKIKL
NKKDEKGRDKGKGKKRPNRGKAKPVVSDFDSDEEQDEREQSEGSGTDDE
Download sequence
Identical sequences ENSMMUP00000020041 ENSMMUP00000020039 9544.ENSMMUP00000020039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]