SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020066 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020066
Domain Number 1 Region: 769-975
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000989
Further Details:      
 
Domain Number 2 Region: 280-562
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.88e-47
Family FCH domain 0.0095
Further Details:      
 
Domain Number 3 Region: 696-749
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020066   Gene: ENSMMUG00000015301   Transcript: ENSMMUT00000021454
Sequence length 1132
Comment pep:known chromosome:MMUL_1:19:814062:833160:1 gene:ENSMMUG00000015301 transcript:ENSMMUT00000021454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRKKRDLMKTPSISKKNRAGSPSPQPSGELPRKDGVDAVFPGPSLEPSTGSSSAKATG
TLKRPTSLSRHASAAGFPLSGAASWTLGRSHRSPLTAASPGEQPTEGAGPDGVEDISHLL
ADVARFAEGLEKLKECVLHDDLLEARRPLAHECLGEALRVMRQIISKYPLLNTVETLTAA
GTLIAKVKAFHYESNNDLEKQEFEKALETIAVAFSSTVSEFLMGEVDSSTLLAVPPGDSS
QSMESLYGPGSEGTPPGLDDCDAGCLPAEEVDVLLQRCEGGVDAALLYAKNMAKYMKDLI
SYLEKRTTLEMEFAKGLQKICHNCRQSVMQEPHMPLLSIYSLALEQDLEFGHGMVQAVGT
LQTQTFMQPLTLRRLEHEKRRKEIKEAWHRAQRKLQEAESNLRKAKQGYTQRCEDHDKAR
FLVAKAEEEQAGTTLGAGSTVTKTLDKRRRLEEEAKNKAEEAMATYRTCVADAKTQKQEL
EDTKVTALRQIQEVIRQSDQTIKSATISYYQMMHMQTAPLPVHFQMLCESSKLYDPGQQY
ASHVRQLQRDQEPDVHYDFEPHVSANAWSPVLRARKSSFNVSDVAGPEAAGSPPEEGIEG
APAKERRAGRGHQVHKSWPLSISDSDSGLDTGPGTGDFKKFERTSSSGTMSSTEELVDPE
GGAGASAFEQADLNGMTPELPVAVPSGPFRHEGLSKAARTHRLRKLRTPAKCRECNSYVY
FQGAECEECCLACHKKCLETLAIQCGHKKLQGRLQLFGQDFSQAARSAPDGVPFIVKKCV
CEIERRALRTKGIYRVNGVKTRVEKLCQAFENGKELVELSQASPHDISNVLKLYLRQLPE
PLISFRLYHELVGLAKDSLKAEAEAKAASRGRQDGSESEAVMVAMAGRLRELLRDLPLEN
RASLQYLLRHLRRIVEVEQDNKMTPGNLGIVFGPTLLRPRPTEATVSLSSLVDYPHQARV
IETLIVHYGLVFEEEPEETPGDQDESSSQRAEVVIQVPYLEAGEGVVYPLQEAAEDGCRE
SRVVSNDSDSDLEEASELLSSSEASALRRLSLLEQQQSEASLEEASGSHSGSEERLEATA
REDGDEDDPARQLSGFNTNQSNNVLQAPLPTMRLRGGRIAPGSCRERRPEFV
Download sequence
Identical sequences XP_014977817.1.72884 9544.ENSMMUP00000020066 ENSMMUP00000020066 ENSMMUP00000020066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]