SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020073 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020073
Domain Number 1 Region: 28-115
Classification Level Classification E-value
Superfamily F-box domain 5.23e-19
Family F-box domain 0.002
Further Details:      
 
Domain Number 2 Region: 258-403
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 1.57e-16
Family Regulator of chromosome condensation RCC1 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020073   Gene: ENSMMUG00000015309   Transcript: ENSMMUT00000021462
Sequence length 403
Comment pep:known scaffold:MMUL_1:1099548049144:69794:79267:1 gene:ENSMMUG00000015309 transcript:ENSMMUT00000021462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEKAVPLLRRRRVKRSCPSCGPELGVEEKKGKGNPISIQLFPPELVEHIISFLPVRDLV
ALGQTCRYFHEVCDAEGVWRRICRRLSPRLRDQGSGVRPWKRAAILNYTKGLYFQAFGGR
RRCLSKSVAPLLAHGYRRFLPTKDHVFILDYVGTLFFLKNALVSTLGQMQWKRACRYVVL
CRGAKDFASDPRCDTVYRKYLYVLATREQQEVVGTTSSRACDCVEVYLQSSGQRVFKMTF
HHSMTFKQIVLVGQETQRALLLLTEEGKIYSLVVNETQLDQPRSYTVQLALRKVSHYLPH
LRVACMTSNQSSTLYVTDQGGVYFEVHTPGVYRDLFGTLQAFDPLDQQMPLALSLPAKIL
FCALGYNHLGLVDEFGRIFMQGNNRYGQLGTGDKMDRGEPTQV
Download sequence
Identical sequences ENSMMUP00000020073 ENSMMUP00000020073 9544.ENSMMUP00000020073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]