SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020130 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020130
Domain Number 1 Region: 56-300
Classification Level Classification E-value
Superfamily ClpP/crotonase 2.67e-54
Family Crotonase-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020130   Gene: ENSMMUG00000015352   Transcript: ENSMMUT00000021522
Sequence length 307
Comment pep:known chromosome:MMUL_1:4:136594545:136637719:1 gene:ENSMMUG00000015352 transcript:ENSMMUT00000021522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRQEMAKSLLKTSSLSGRTKLLHQTGLSLYSTSHGFYEEEVKKKLQQFPGGSIDLQKE
DSGIGILTLNNPSKMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAV
KSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKI
RFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKYALHIGMVEEVLQSSDETK
SLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIA
KKGKFNK
Download sequence
Identical sequences A0A2K5UN41 A0A2K6B7F5 H9YYZ7
NP_001248434.1.72884 XP_005551813.1.63531 XP_008005315.1.81039 XP_011712353.1.29376 XP_014992771.1.72884 9544.ENSMMUP00000033090 ENSMMUP00000033090 ENSMMUP00000020130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]