SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020134 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000020134
Domain Number - Region: 14-70
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0398
Family FCH domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020134   Gene: ENSMMUG00000015357   Transcript: ENSMMUT00000021527
Sequence length 212
Comment pep:known scaffold:MMUL_1:1099213961744:107:5492:-1 gene:ENSMMUG00000015357 transcript:ENSMMUT00000021527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSSKFFEEDGSLKEVHKINEMYASLQEELKSICKKVEDSEQAVDKLVKDVNRLKREIEKR
KRAQIQAAREKNIQKDPQENIFLCQALRTFFPNSEFLHSCVMSLKSRHVSKSSCNINHHL
DVVDNLTLMVEHTGIPEASSASTPQIIKHKALDLDDRWQFKRSRLLDTQDERSKADTDSS
NQDKASKMSSPETDEEIEKMKGFGEYSRSPTF
Download sequence
Identical sequences ENSMMUP00000020134 9544.ENSMMUP00000020134 ENSMMUP00000020134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]