SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020135 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020135
Domain Number 1 Region: 41-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.34e-16
Family Growth factor receptor domain 0.0011
Further Details:      
 
Domain Number 2 Region: 146-201
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020135   Gene: ENSMMUG00000015355   Transcript: ENSMMUT00000021528
Sequence length 293
Comment pep:known chromosome:MMUL_1:4:136725254:136801539:-1 gene:ENSMMUG00000015355 transcript:ENSMMUT00000021528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHLRLISWFFIMLNFMEYIGSQNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPR
LFFVLERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYL
HLGKCLDNCPEGLEANNHTMECVNIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIM
QHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKGLES
SKETPEQRENKQQQKKRKVQDKQQKSGIEVTLAEGLTSVSQRTQPTPCRRRYL
Download sequence
Identical sequences F6SP05
ENSMMUP00000020135 ENSMMUP00000020135 9544.ENSMMUP00000020135

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]