SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020198 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020198
Domain Number 1 Region: 270-310,338-519
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9e-30
Family beta 1,4 galactosyltransferase (b4GalT1) 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020198
Domain Number - Region: 57-98
Classification Level Classification E-value
Superfamily Prefoldin 0.0235
Family Prefoldin 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020198   Gene: ENSMMUG00000015405   Transcript: ENSMMUT00000021594
Sequence length 542
Comment pep:known chromosome:MMUL_1:9:43286947:43332776:1 gene:ENSMMUG00000015405 transcript:ENSMMUT00000021594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRRGLILHTRTHWLLLGLALLCSLVLFMYLLECAPQTDGNASLPGVVGENYGKEYYQAL
LQEQEEHYQTRATSLKRQIAQLKQELQEMSEKMRSLQERKNVGANGIGYQSNKEQAPSDL
LEFLHSQIDKAEVSIGAKLPSEYGVIPFESFTLMKVFQLEMGLTRHPEEKPVRKDKRDEL
VEVIEAGLEVINNPDEDDEQEDEEGPLGEKLIFNENDFIEGYYRTERDKGTQYELFFKKA
DLMEYRHVTLFRPFGPLMKVKSEMIDITRSIINIIVPLAERTEAFVQFMQNFRDVCIHQD
KKIHLTVVYFGKEGLSKVKSILESVTSESNFHNYTLVSLNEEFNRGRGLNVGARAWDKGE
VLMFFCDVDIYFSAEFLNSCRLNAEPGKKVFYPVVFSLYNPAIVYANQEVPPPVEQQLVH
KKDSGFWRDFGFGMTCQYRSDFLSIGGFDMEVKGWGGEDVHLYRKYLHGDLIVIRTPVPG
LFHLWHEKRCADELPPEQYRMCIQSKAMNEASHSHLGMLVFREEIETHLHKQAYRTNSEA
VG
Download sequence
Identical sequences A0A2K5UHT9 H9ESV6
ENSMMUP00000020198 9544.ENSMMUP00000020198 ENSMMUP00000020198 NP_001165641.1.72884 XP_005565096.1.63531 XP_015002354.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]