SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020220 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020220
Domain Number 1 Region: 391-492
Classification Level Classification E-value
Superfamily Bromodomain 8.24e-29
Family Bromodomain 0.00043
Further Details:      
 
Domain Number 2 Region: 869-988
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 1.2e-19
Family PWWP domain 0.016
Further Details:      
 
Domain Number 3 Region: 6-77
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 8.86e-17
Family PHD domain 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020220
Domain Number - Region: 115-154
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000443
Family PHD domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020220   Gene: ENSMMUG00000015416   Transcript: ENSMMUT00000021616
Sequence length 1004
Comment pep:known chromosome:MMUL_1:4:35965871:35984671:1 gene:ENSMMUG00000015416 transcript:ENSMMUT00000021616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVHQECYGVPYIPEGQWLCRCCL
QSPSRPVDCVLCPNKGGAFKQTSDGHWAHVVCAIWIPEVCFANTVFLEPIEGIDNIPPAR
WKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFMKIEPMRETSLNGTIFTVRKT
AYCEAHSPPSTATARRKGDSPRSISETGDEEGLKEGDGEEEEEEEVEEEEQEGQGGVSGP
LKGVPKKNKMSLKQKIKKEPEEAGQDTPSTLPLVTVPQIPSYRLNKICSGLSFQRKNQFM
QRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDEKTSAVKEELKYWQKLRHDLE
RARLLIELIRKREKLKREQVKVQQAAMELELMPFNVLLRTTLDLLQEKDPAHIFAEPGLS
RVPDYLEFISKPMDFSTMRRKLESHLYRTLEEFEEDFNLIVTNCMKYNAKDTIFHRAAVR
LRDLGGAILRHARRQAENIGYDPERGTHLPESPKLEDFYRFSWEDVDNILIPENRAHLSP
EVQLKELLEKLDLVSAMRSSGARTRRVRLLRREINALRQKLAQPPPPQPPSLNKTVSNGE
LPAGPQGDAAVLEQALQEEPEDDGDRDDSKLPPPPTLEPTGPAPSLSEQESPPEPPTLKP
INDSKPPSRFLKPRKVEEDELLEKSPLQLGSEPLQRLLSDNGINRLSLMAPDTPGGTPLS
GVGRRTSVLFKKAKNGVKLQRSPDRALENGEDHGVAGSPASPASIEDERHSRKRPRSGSC
SESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSGGLAFEACSGLTPPKRSRGKPA
LSRVPFLEGVNGDSDYNGSGRSLLLPFEDRGDLEPLELVWAKCRGYPSYPALIIDPKMPR
EGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFDNKRTWQWLPRDKVLPLGVEDT
VDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGPHSFVTSSYL
Download sequence
Identical sequences ENSMMUP00000020221 ENSMMUP00000020220 9544.ENSMMUP00000020221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]