SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020299 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020299
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-24
Family Third domain of FERM 0.0059
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 1.03e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.36e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.00000812
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020299   Gene: ENSMMUG00000015474   Transcript: ENSMMUT00000021700
Sequence length 445
Comment pep:known chromosome:MMUL_1:4:16103739:16122617:1 gene:ENSMMUG00000015474 transcript:ENSMMUT00000021700 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQIDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVS
AMENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFLQCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSNQSPSHSPLKSSESSMNC
SSCEGLSCQQTRALQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCATQLQSCPV
CRSHVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences 9544.ENSMMUP00000020300 ENSMMUP00000020300 ENSMMUP00000020299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]