SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020309 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020309
Domain Number 1 Region: 57-191
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 1.96e-39
Family MOSC N-terminal domain-like 0.004
Further Details:      
 
Domain Number 2 Region: 52-107,212-331
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 9.1e-17
Family MOSC (MOCO sulphurase C-terminal) domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020309   Gene: ENSMMUG00000015483   Transcript: ENSMMUT00000021710
Sequence length 335
Comment pep:known chromosome:MMUL_1:1:149536378:149572680:-1 gene:ENSMMUG00000015483 transcript:ENSMMUT00000021710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGASSSSALARLGLPAQARPRWLGVAVLGLAAVALGAVAWRRAWPRRRRRLQQVGTVAKL
WIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVIKEDGHMVTARQEPRLVLVSITYEN
NCLIFKAPDMDQLVLPSKQPSSNKLHNCRIFGLDIKGRDCGNEAAQWFTNFLKTEVYRLV
QFETNMKGRTSRKLLPTLDQNYQVAYPDCSPLLIMTDASLVDLNTRIEKKMKMENFRPNI
VVTGCDAFEEDTWDELLIGSVEVKKIMACPRCILTTVDPDTGVIDRKEPLDTLKSYRLCD
PSERELYKLSPLFGIYYSVEKIGSLRVGDPVYRMV
Download sequence
Identical sequences A0A2K5V4L4 F6SCU0
NP_001244406.1.72884 9544.ENSMMUP00000020309 ENSMMUP00000020309 ENSMMUP00000020309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]