SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020312 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020312
Domain Number 1 Region: 58-191
Classification Level Classification E-value
Superfamily MOSC N-terminal domain-like 5.23e-38
Family MOSC N-terminal domain-like 0.0052
Further Details:      
 
Domain Number 2 Region: 52-108,213-334
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 1.22e-20
Family MOSC (MOCO sulphurase C-terminal) domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020312   Gene: ENSMMUG00000015485   Transcript: ENSMMUT00000021713
Sequence length 337
Comment pep:known chromosome:MMUL_1:1:149505367:149533465:-1 gene:ENSMMUG00000015485 transcript:ENSMMUT00000021713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGSSALAGFVLLAQPRPGWLGVAVLGLTAVALGAVAWRRAWPTQRRRLLQQVGTVAQ
LWIYPVKSCKGVPVSEAECTAMGLRSGNLRDRFWLVINQEGNMVTARQEPRLVLISLTCD
GDTLTLSAAYTKDLLLPIKTPTTNAVRKCRVHGLEIEGRDCGEAAAQWITSFLKSQSYRL
VHFEPHMRPRHPHQIADLFRPKDQIAYSDTSPFMILSEASLADLNSRLEKKVKATNFRPN
IVISGCDVYAEDSWDQLLIGDVELKRLMACSRCILTTVDPDTGVMSRKEPLETLKSYRQC
DPSERKLYGKSPLFGQYFVLENPGTIKVGDPVYLLGQ
Download sequence
Identical sequences 9544.ENSMMUP00000020312 ENSMMUP00000020312 XP_001102284.1.72884 ENSMMUP00000020312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]