SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020398 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020398
Domain Number 1 Region: 76-134
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.62e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020398   Gene: ENSMMUG00000015552   Transcript: ENSMMUT00000021808
Sequence length 172
Comment pep:known chromosome:MMUL_1:11:108837277:108839521:1 gene:ENSMMUG00000015552 transcript:ENSMMUT00000021808 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METRKPAGLLALPYSLRAAPLGVPGTLAGLPRREPLRVALRLDAACWEWARSGCSRKRQF
LPLPLDGAFEPACLRKRNERERQRVRCVNEGYARLRDHLPRELADKRLSKVETLRAAIGY
IKHLQELLERQTRGPEGATGAVPQRRAECNSDGESKASSAPSPSSEPEEGGS
Download sequence
Identical sequences ENSMMUP00000020398 ENSMMUP00000020398 9544.ENSMMUP00000020398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]