SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020460 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020460
Domain Number 1 Region: 918-1109
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.22e-43
Family BCR-homology GTPase activation domain (BH-domain) 0.00081
Further Details:      
 
Domain Number 2 Region: 63-97
Classification Level Classification E-value
Superfamily WW domain 0.000000122
Family WW domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020460   Gene: ENSMMUG00000015596   Transcript: ENSMMUT00000021875
Sequence length 1114
Comment pep:known chromosome:MMUL_1:8:147195782:147270491:-1 gene:ENSMMUG00000015596 transcript:ENSMMUT00000021875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQTQDYECRSHNVDLPESRIPGSSTRLEWVEIIEPRTRERMYANLVTGECVWDPPAGVR
IKRTSENQWWELFDPNTSRFYYYNASTQRTVWHRPQGCDIIPLAKLQTLKQNTESPRASA
ESSPGRGSSVSREGSTSSSLEPEPDTEKAQELPARTGRPAAFGALKEDSGSSSPPGVFLE
KDYEIYRDYSADGQLLHYRTSSLRWNLGAKERMLIKVADREPSFLAAQGNGYAPDGPPGV
RSRRPSGSQHSPSLQTFAPEADGTIFFPERRPSPFLKRAELPGSSSPLLAQPRKPSGDSQ
PSSPRYGYEPPLYEEPPVEYQAPIYDEPPMDVQFEAGGGYQAGSPQRSPGRKPRPFLQPN
KQGPPSPCQQLVLTKQKCPERFLSLEYSPAGKEYVRQLVYVEQAGSSPKLRAGPRHKYAP
NPGGGSYSLQPSPCLLRDQRLGVKSGDYSTMEGPELRHSQPPTPLPQAQEDAMSWSSQQD
TLSSTGYSPGTRKRKSRKPSLCQATSATPTEGPGDLLVEQPLAEEQPPCGTSLAPVKRAE
GEADGARGAAEPFLAQARLAWEAQQAHFHMKQRSSWDSQQDGSGYESDGALPLPMPGPVV
RAFSEDEALAQQENKHWRRGTFEKLGFPQILLEKSISVQTNLASPEPYLHPSQSEDLGAC
AQFESSRQSRSGIPSASCVFPTFTLRKPSSETDIENWASKHFNKHTQGLFRRKVSIANML
AWSSESIKKPMIVTSDRHVKKEACELFKLIQMYMGDRRAKADPLHVALEVATKGWSVQGL
RDELYIQLCRQTTENFRLESLARGWELMAICLAFFPPTPKFHSYLEGYIYRHMDPVNDTK
VTQHIKELLERNTKKKSKLRKKPKPYVEEPDGVAISTYAKYCYHKLQKAALTGAKKGLKK
PNVEEIRHAKNAVFSPSMFGSALQEVMGMQRERYPERQLPWVQTRLSEEVLALNGDQTEG
IFRVPGDIDEVNALKLQVDQWKVPTGLEDPHVPASLLKLWYRELEEPLIPHEFYEQCIAH
YDSPEAAVAVVHALPRINRMVLCYLIRFLQVFVQPANVAVTKMDVSNLAMVMAPNCLRCQ
SDDPRVIFENTRKEMSFLRVLIQHLDTSFMEGVL
Download sequence
Identical sequences A0A2K5UEB5
ENSMMUP00000031829 ENSMMUP00000020460 9544.ENSMMUP00000031829 XP_015001776.1.72884 XP_015001778.1.72884 XP_015310880.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]