SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020472 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020472
Domain Number 1 Region: 769-964
Classification Level Classification E-value
Superfamily Fibronectin type III 6.75e-40
Family Fibronectin type III 0.0000386
Further Details:      
 
Domain Number 2 Region: 1177-1269
Classification Level Classification E-value
Superfamily Immunoglobulin 9.11e-23
Family I set domains 0.0047
Further Details:      
 
Domain Number 3 Region: 1060-1169
Classification Level Classification E-value
Superfamily Fibronectin type III 1.04e-22
Family Fibronectin type III 0.0018
Further Details:      
 
Domain Number 4 Region: 369-458
Classification Level Classification E-value
Superfamily Immunoglobulin 8.85e-17
Family I set domains 0.0000275
Further Details:      
 
Domain Number 5 Region: 654-768
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-16
Family I set domains 0.0000028
Further Details:      
 
Domain Number 6 Region: 157-258
Classification Level Classification E-value
Superfamily Immunoglobulin 1.21e-16
Family I set domains 0.00000204
Further Details:      
 
Domain Number 7 Region: 446-529
Classification Level Classification E-value
Superfamily Immunoglobulin 4.5e-16
Family I set domains 0.0029
Further Details:      
 
Domain Number 8 Region: 980-1069
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000653
Family I set domains 0.014
Further Details:      
 
Domain Number 9 Region: 12-97
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000012
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 544-621
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000248
Family I set domains 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020472   Gene: ENSMMUG00000015604   Transcript: ENSMMUT00000021887
Sequence length 1272
Comment pep:known chromosome:MMUL_1:14:24766390:24789837:1 gene:ENSMMUG00000015604 transcript:ENSMMUT00000021887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEPGKKPVSAFSKKPRSVEVAAGSPAVFEVETERAGVKVRWQRGGSDIGASSKYGLATE
GTRHTLTVREVGPADQGSYAVIAGSSKVKFDLKVTEAEKAEPVLAPAPAPAEATGTPGET
LAPAAELGESAPSPEGSSSAARNDPTPGAPDDPIGLFVMRPQDGEVTVGGSITFSARVAG
ASLLKPPVVKWFKGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGGYRCE
VSTKDKFDCSNFNLTVHEAVGTGDLDLLSSFRRTSLAGGGRRISDSHEDAGILDFSSLLK
KSSSFRTPRDSKLEAPAEEDVWEILRQAPPSEYERIAFQYGVTDLRGMLKRLKGMRRDEK
KSTAFQKKLEPAYQVSKGHKIRLTVELADPDAEVKWLKNGQEIQMSGRYIFESIGAKRTL
TISQCSLADDAAYQCVVGGEKCSTELFVKEPPVLITRPLEDQLVMVGQRVEFECEVSEEG
AQVKWLKDGVELTREETFKYRFKKDGRRHRLIINEATLEDMGHYALRTSGGQALAELIVQ
EKKLEVYQSIADLTVGAKDQAVFKCEVSDENVRGVWLKNGKELVPDSRIKPVLPCRVHKL
TIDDVTPADEADYSFVPEGFACNLSAKLHFMEVKIDFVPRQEPPKIHLDCPGRIPDTIVV
VAGNKLRLDVPISGDPAPTVIWQKAITQGNKSPARPAPDAPEDAGDSDEWVFDKKLLCET
EGRVRVETTKDRSIFTVEGAEKEDEGVYTVTVKNPVGEDRVNLTVKVIDVPDAPAAPKVS
NVGEDSCTVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLIQELSHEARRMIEGVV
YEMRVYAVNAIGMSRPSPASQPFMPIGPPSEPTHLAVEDASDTTVSLKWRPPERVGAGGL
DGYSVEYCPEGGSEWVAALRGLTEHTSILVKDLPTGARLLFRVRAHNMAGPGAPVTTTEP
VTVQEILQRPRLQLPRHLRQTIQKKVREPVNLLIPFQAMPRPQVTWTKEGQPLAEEVSVR
NSPTDTILFIRAARRAHSGTYQVTVRIENMEDKATLVLQVVDKPSPPQDLRVTEAWGLNV
ALEWKPPQDDGNTELWGYTVQKADKKTMEWFTVLEHYRRTHCVVPELIIGNGYYFRVFSQ
NMVGSSDTAATTKEPVFIPRPGITYEPPDYKALDFSEAPSFTQPLVNRSVIAGYTTMLCC
AVRGSPKPKISWFKNGLDLGEDARFRMFSKQGVLTLEIRKPCPFDGGIYVCRATNLQGEA
QCECRLEVRVPQ
Download sequence
Identical sequences ENSMMUP00000020472 9544.ENSMMUP00000020472 ENSMMUP00000020472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]