SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020491 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020491
Domain Number 1 Region: 117-380
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-67
Family Protein kinases, catalytic subunit 0.000000771
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020491
Domain Number - Region: 393-442
Classification Level Classification E-value
Superfamily SH3-domain 0.000186
Family SH3-domain 0.0043
Further Details:      
 
Domain Number - Region: 10-68
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0673
Family SAM (sterile alpha motif) domain 0.026
Further Details:      
 
Domain Number - Region: 603-635
Classification Level Classification E-value
Superfamily UBA-like 0.085
Family UBA domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020491   Gene: ENSMMUG00000015616   Transcript: ENSMMUT00000021906
Sequence length 666
Comment pep:known chromosome:MMUL_1:16:7109192:7117018:1 gene:ENSMMUG00000015616 transcript:ENSMMUT00000021906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEAGSLWLLKLLRDIQLAQFYWPILQELNVTRPEHFDFVKPEDLDGIGMGRPAQRRLS
EALKRLRSGPKSKNWVYKILGGFAPEHKEPTLPSDSPAHLPEPEGGLKCLIPEGAVCRGE
LLGSGCFGVVHRGLWTLPNGKSVPVAVKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHV
LRLHGLVLGQPLQMVMELAPLGSLHARLTASAPTPPLPVSLLCLFLRQLAGAMAYLGSRG
LVHRDLATRNLLLASPRTIKVADFGLVRPLGGTRGRYVMGGPRPIPYAWCAPESLRHGAF
SSASDVWMFGVTLWEMFSGGEEPWAGVPPYLILQRLEDRARLPRPPICSRALYSLALRCW
APHPADRPSFSHLEGLLQEAWPSEGCCVRDVTEPGALRMETGDPITVIEGSSSFHSPDST
IWKGQNGRTFKVGSFPASAVTLADAGGLPVTRPVHRGTPARGDQHPGNIDGDRKKANVWD
VPPARGQRRNVPLERMKGISRSLESVLSLGPRPTGGGSSPPEIRQARAVPQGPPGLPPRP
PLSSSSPQPSQPPRERLPWPKRKPPHNHPMGAPGASKAAALSGGLLPDPELQRKIMEVEL
SVHGVTHQECQTALGATGGDVVSAIRNLKVDQLFHLSSRSRADCRRILEHYQWDLSAASR
YVLARP
Download sequence
Identical sequences F6SZ58
ENSMMUP00000020491 9544.ENSMMUP00000020491 ENSMMUP00000020491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]