SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020679 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020679
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.2e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020679   Gene: ENSMMUG00000015749   Transcript: ENSMMUT00000022106
Sequence length 450
Comment pep:known chromosome:MMUL_1:7:23976302:24032983:1 gene:ENSMMUG00000015749 transcript:ENSMMUT00000022106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQAGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAVVEPSERHFYQPIWTLVGAGAKQLSSSGRPMASVIPSGVEWIKARVTE
LNPDKNCIHTDNDEQISYRYLIIALGIQLHYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIRERNLTVNYKQNLTEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMGP
PDVLKTSPVADAAGWVDVDKETLQHKRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYVMKAD
LMPFLYWNMMLRGYWGGPAILRKLFHLGMS
Download sequence
Identical sequences F6S067
ENSMMUP00000020679 ENSMMUP00000020679 9544.ENSMMUP00000020679 XP_001112121.1.72884 XP_014997635.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]