SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020756 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020756
Domain Number 1 Region: 83-338
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.86e-75
Family Crotonase-like 0.000000000525
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020756   Gene: ENSMMUG00000015798   Transcript: ENSMMUT00000022186
Sequence length 339
Comment pep:known chromosome:MMUL_1:15:103022122:103167872:-1 gene:ENSMMUG00000015798 transcript:ENSMMUT00000022186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVAAAPGALGALHAGGARLVAACSARLCPGLRLPSSLAGRRVGPAIWAQGWVPAAGG
PAPKRGYSSEMKTEDELRVRHLEEENRGIVVLGINRAYGKNALSKNLIKMLSKAVDALKS
DKKVRTIIIRSEVPGIFCAGADLKERAKMSSSEVGPFVSKIRAVINDIANLPVPTIAAID
GLALGGGLELALACDIRVAASSAKMGLVETKLAIIPGGGGTQRLPRAIGMSLAKELIFSA
RVLDGQEAKAVGLISHVLEQNQEGDAAYRKALDLAREFLPQGPVAMRVAKLAINQGMEVD
LVTGLAIEEACYAQTIPTKDRLEGLLAFKEKRPPRYKGE
Download sequence
Identical sequences A0A2K5WCU2 A0A2K6E3E7 F7APJ9
ENSMMUP00000020756 ENSMMUP00000020756 9544.ENSMMUP00000020756 NP_001244604.1.72884 XP_005582286.1.63531 XP_011769479.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]