SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020790 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020790
Domain Number 1 Region: 364-572
Classification Level Classification E-value
Superfamily TPR-like 1.76e-38
Family Tetratricopeptide repeat (TPR) 0.0014
Further Details:      
 
Domain Number 2 Region: 575-748
Classification Level Classification E-value
Superfamily TPR-like 1.71e-26
Family Tetratricopeptide repeat (TPR) 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020790
Domain Number - Region: 326-375
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 0.0145
Family S-adenosylmethionine decarboxylase 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020790   Gene: ENSMMUG00000015817   Transcript: ENSMMUT00000022221
Sequence length 774
Comment pep:known chromosome:MMUL_1:11:29829143:29984176:-1 gene:ENSMMUG00000015817 transcript:ENSMMUT00000022221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPFYFHAVNVILHCLVTLVLMYTCDKTVFKNRGLAFVTALLFAVHPIHTEAVAGIVGRA
DVLACLLFLLAFLSYNRSLDQGCVGESFPSTVSPFFLLFSLFLGTCAMLVKETGITVFGV
CLVYDLFSLSNKEDKSSNGALCPCSPQQPGSPQPSSLPGHPHRENGKQQRFPHKGAWGGC
HSPLPPEPKSSGFPVSPRAVWSMMRFLTYSYLLAFNVWLLLAPVTLCYDWQVGSIPLVET
IWDMRNLATILLAVVMALLSLHCLAAFKRLEHKEVLVGLLFLVFPFIPASNLFFRVGFVV
AERVLYMPSMGYCILFVHGLSKLCTWLNRCGATTLIVSTVLLLLLFSWKTVKQNEIWLSR
ESLFRSGVQTLPHNAKVHYNYANFLKDQGRNKEAIYHYRTALKLYPRHASALNNLGTLIR
DTAEAKMYYQKALQLHPQHNRALFNLGNLLKSQEKKEEAITLLKDSIKYGPEFADAYSSL
ASLLAEQERFKEAEEIYQAGIKNCPDSSDLHNNYGVFLVDTGLPEKAVAHYQQAIKLSPS
HHVAMVNLGRLYRSLGENSMAEEWYKRALQVAHKAEILSPLGALYYNTGRYEEALQIYQE
AAALQPSQRELRLALAQVLAVMGQTKEAEKMTNHIVSEETGCLECYRLLSAIYSKQENHD
KALDVIEKALQLKPKDPKVISELFFTKGNQLREQNLLDKAFESYRVAVQLNPDQAQAWMN
MGGIQHIKGKYVSARAYYERALQLVPDSKLLKENLAKLDRLEKRLQEVREKDQT
Download sequence
Identical sequences F7AGF7 G7PHJ6
9544.ENSMMUP00000020786 ENSMMUP00000020790 XP_011743833.1.29376 ENSMMUP00000020786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]