SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020812 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020812
Domain Number 1 Region: 162-319
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 4.71e-67
Family DNA-binding protein LAG-1 (CSL) 0.000000856
Further Details:      
 
Domain Number 2 Region: 16-164
Classification Level Classification E-value
Superfamily p53-like transcription factors 3.73e-66
Family DNA-binding protein LAG-1 (CSL) 0.0000107
Further Details:      
 
Domain Number 3 Region: 320-432
Classification Level Classification E-value
Superfamily E set domains 7.28e-42
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020812   Gene: ENSMMUG00000015828   Transcript: ENSMMUT00000022244
Sequence length 486
Comment pep:known chromosome:MMUL_1:5:21172569:21215029:1 gene:ENSMMUG00000015828 transcript:ENSMMUT00000022244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWIKRKFGERPPPKRLTREAMRNYLKERGDQTVLILHAKVAQKSYGNEKRFFCPPPCVY
LMGSGWKKKKEQMERDGCSEQESQPCAFIGIGNSDQEMQQLNLEGKNYCTAKTLYISDSD
KRKHFMLSVKMFYGNSDDIGVFLSKRIKVISKPSKKKQSLKNADLCIASGTKVALFNRLR
SQTVSTRYLHVEGGNFHASSQQWGAFFIHLLDDDESEGEEFTVRDGYIHYGQTVKLVCSV
TGMALPRLIIRKVDKQTALLDADDPVSQLHKCAFYLKDTERMYLCLSQERIIQFQATPCP
KEPNKEMINDGASWTIISTDKAEYTFYEGMGPVLAPVTPVPVVESLQLNGGGDVAMLELT
GQNFTPNLRVWFGDVEAETMYRCGESMLCVVPDISAFRQGWRWVRQPVQVPVTLVRNDGI
IYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSS
TATVVS
Download sequence
Identical sequences A0A2K6CZ18 H9FTZ8
ENSMMUP00000020812 ENSMMUP00000020813 NP_001247622.1.72884 XP_011749737.1.29376 XP_011749738.1.29376 XP_011749739.1.29376 XP_014993587.1.72884 9544.ENSMMUP00000020813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]