SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020826 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020826
Domain Number 1 Region: 19-88
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0000824
Family Chromo domain 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020826   Gene: ENSMMUG00000015841   Transcript: ENSMMUT00000022259
Sequence length 234
Comment pep:known chromosome:MMUL_1:7:158956596:158957610:-1 gene:ENSMMUG00000015841 transcript:ENSMMUT00000022259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGAAPGRKTSDLQQKNVEVKTKKNQKTPGSGDGGSTSETPQPPRKERAQVDPTVENEET
FMNRVEVKVKIPEELKLWLVDDWDLITRQKHLFYLPAKKNVDSILEDYANYKKSRGNTDN
KEYAVNEVTGGSQEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQVYEAPHLLRLFVR
IRAMLAYTPLDEKSLALLLNYLHDFLKYLAKNSATLLSASHYEVAPPEYHRKAV
Download sequence
Identical sequences ENSMMUP00000020826 ENSMMUP00000020826 9544.ENSMMUP00000020826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]