SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020863 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020863
Domain Number 1 Region: 82-133
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000113
Family HLH, helix-loop-helix DNA-binding domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020863   Gene: ENSMMUG00000015867   Transcript: ENSMMUT00000022298
Sequence length 214
Comment pep:known chromosome:MMUL_1:13:27110614:27114286:1 gene:ENSMMUG00000015867 transcript:ENSMMUT00000022298 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQRKARGLPAMPGVGHSQTQAKARLLPGADRKRSRLSRTRQDPWEERSWSNQRWSRATP
GPRGTRAGGLALGRSEACPENAARERSRVRTLRQAFLALQAALPAVPPDTKLSKLDVLVL
AASYIAHLTRTLGHELPGPAWPPFLRGLRYLHPLKKWPMRSRLYAGGLGYSDLDSTTAST
PSQRTRDVEVGSQVPGEADALFSAMPLSPALGDK
Download sequence
Identical sequences F7C240
ENSMMUP00000020863 NP_001247551.1.72884 9544.ENSMMUP00000020863 ENSMMUP00000020863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]