SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020950 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020950
Domain Number 1 Region: 2-278
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.49e-78
Family FCH domain 0.0000000165
Further Details:      
 
Domain Number 2 Region: 509-582
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000184
Family SH3-domain 0.0015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000020950
Domain Number - Region: 387-454
Classification Level Classification E-value
Superfamily HR1 repeat 0.0131
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020950   Gene: ENSMMUG00000015922   Transcript: ENSMMUT00000022391
Sequence length 596
Comment pep:known chromosome:MMUL_1:1:96528474:96580309:1 gene:ENSMMUG00000015922 transcript:ENSMMUT00000022391 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQFDSLDKHTQWGIDFLERYAKFVKERIEIEQNYAKQLRNLVKKYCPKRSSKDEEPRFTS
CVAFFNILNELNDYAGQREVVAEEMAHRVYGELMRYAHDLKTERKMHLQEGRKAQQYLDM
CWKQMDNSKKKFERECREAEKAQQSYERLDNDTNATKADVEKAKQQLNLRTHMADENKNE
YAAQLQNFNGEQHKHFYVVIPQIYKQLQEMDERRTIKLSECYRGFADSERKVIPIISKCL
EGMILAAKSVDERRDSQMVVDSFKSGFEPPGDFPFEDYSQHIYRTISDGTISASKQESGK
MDAKTTVGKAKGKLWLFGKKPKPQSPPLTPTSLFTSSTPNGSQFLTFSIEPVHYCMNEIK
TGKPRIPSFRSLKRGGPALEDFSHLPPEQRRKKLQQRIDELNRELQKESDQKDALNKMKD
VYEKNPQMGDPGSLQPKLAETMNNIDRLRMEIHKNEAWLSEVEGKTGGRGDRRHSSDINH
LVTQGRESPEGSYTDDANQEVRGPPQQHGHHSEFDDEFEDDDPLPAIGHCKAIYPFDGHN
EGTLAMKEGGVLYIIEEDKGDGWTRARRQNGEEGYVPTSYIDVTLEKNSKGAVTYI
Download sequence
Identical sequences ENSMMUP00000020950 ENSMMUP00000020950 9544.ENSMMUP00000020950

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]