SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021185 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021185
Domain Number 1 Region: 119-298
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.16e-27
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 2 Region: 2-102
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000023
Family Laminin G-like module 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021185   Gene: ENSMMUG00000016104   Transcript: ENSMMUT00000022647
Sequence length 2239
Comment pep:known chromosome:MMUL_1:7:54582000:54597775:-1 gene:ENSMMUG00000016104 transcript:ENSMMUT00000022647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVRLVLGQEELRLQTPAETLLSDSVPHTTVLTVVEGWATLSVDGFLNASSAVPGAPLEV
PYGLFVGGTGSLGLPYLRGTSRPLRGCLHAATLNGRSLLRPLTPDVHEGCAEEFSAGDDV
ALGFSGPHSLAAFPAWGTQDEGTLEFTLTTQSRQAPLAFQAGGRRGDFIYVDIFEGHLRA
VVEKGQGTVLLHNSVPVADGQPHEVSVHINAHQLEVSVDQYPTRTSNRGALSYLEPRGSL
LLGGLDAEASRHLQEHRLGLTPEATNASLLGCMEDLSVNGQRRGLREALLTRNMVAGCRL
EEEEYEDDAYGHYEAFSTLAPEAWPAMELPEPCVPEPGLPPVFANFTQLLTISPLVVAEG
GTAWLEWRHLQPTLDLMEAELRKSQVLFSVTQGARHGELELDIPGAQARKMFTLLDVVNR
KARFIHDGSEDTSDQLVLEVSVTARVPMPSCLRRGQTYLLPIQVNPVNDPPRIIFPHGSL
MVILEHTQKPLGPEVFQAYDPDSACEGLTFQFLGTPSGLPVQRRDQPGEPATEFSCRELE
AGSLVYVHHGGPAQDLTFRVSDGLQASPPATLKVVAVRPAIQIHRSTGLRLAQGSAMPIL
PANLSVETNAVGQDVSVLFRVTRALQFGELQKQGAGGVEGAEWWATQAFHQRDVEQGRVR
YLSTDPQHRTEDTVENLALEVQVGQEILSNLSFPVTIQRATVWMLRLEPLHTQNTQQETL
TTAHLEASLEEAGPSPPAFHYEVVQAPRKGNLQLQGTRLSDGQGFTQDDIQAGRVTYGAT
ARASEAVEDTFRFRVTAPPYFSPLYTFPIHIGGDPDAPVLTNVLLMVPEGGEGVLSADHL
FVKSLNSASYLYEVMERPRHGRLAWRGTQDKTTMVTSFTNEDLLRGRLVYQHDDSETTED
DIPFVATRQGESSGDMAWEEVRGVFRVAIQPVNDHAPVQTISRVFHVARGGRRLLTTDDV
AFSDADSGFADAQLVLTRKDLLFGSIVAVDEPTRPIYRFTQEDLRKRRVLFVHSGADRGW
IQLQVSDGQHQATALLEVQASEPYLRVANGSRLVVPQGGQGTIDTAVFHLDTNLDIRSGD
EVHYHVTAGPRWGQVLRAGQPATAFSQQDLLDGAVLYSHNGSLSPRDTLAFSVEAGPVHT
DATLQVTVALEGPLAPLKLVRHKKIYVFQGEAAEIRRDQLEAAQEGVPPADIVFSVKKPP
SAGYLVMVSRGVLADEPPSLDPVQSFSQEAVDTGRVLYLHSRPEAWSDAFSLDVASGLGA
PLEGVRMELEVLPAAIPLDAQNFSVPEGGSLTLAPPLLRVTGPYFPTLPGLGLQVLEPPR
HGALQKEDEPQARTLSAFSWREVEEQLIRYVHDGSETLTDSFVLMANASEMDRQSHPVAF
TVTVLPVNDQPPVLTTNTGLQMWEGATAPIPAEVLRSTDGDSGSEDLVYTIEQPSNGRVV
LRAAPGTEVRSFTQAQLDGGLVLFSHRGTLDGGFRFGLSDGEHTSSGHFFRVTAQKQVLL
SLEGSRTLTVCPGSVQPLSSQTLRASSSAGTDPQLLLYRVVRGPQLGRLFHAQQDSTGEA
LVNFTQAEVRAHFAATTQTPPASGWQGKDLLSLALSLLRGADAANTLKLIVSGEALASER
GHTCVPPPGLWVPEGQRAKITMAALDASNLLASVPSSQRLEHDVLFQVTQFPSRGQLLVS
EEPLHAGQPHFLQSQLAAGQLVYAHGGGGTQQDGFHFRAHLQGPAGATVAGPQTSEAFAI
TVRDVNERPPQPQASVPLRITRGSRAPISRAQLSVVDPDSAPGEIEYEVQRAPHNGFLSL
VGGGPGPVTHFTQADVDSGRLAFVANGSSVAGVFQLSMSDGASPPLPMSLAVDILPSAIE
VQLQAPLEVPQALGRSSLSQQQLRVVSDREEPEAAYRLIQGPKYGHLLVGGRPASAFSQL
QIDQGEVVFAFTNFSSSHDHFRVLALARGVNASAVVNITVRALLHVWAGGPWPQGATLRL
DPTILDAGELANRTGSVPHFRLLEGPRHGRVVRVPRARTEPGGSQLVEQFTQQDLEDGRL
GLEVGRPEGRAPSPTGDSLTLELWAQGVPPAVASLDFATEPYNAARPYSVALLSVPEATR
MEAGKPESSTPTGEPGPMASSPVPAVAKGGFLGFLEANMFSVIIPVCLVLLLLALILPLL
FYLRKRNKTGKHDVQVLTAKPRNGLAGDTETFRKVEPGQAIPLTAVPGQGPPPGGQPDPE
LLQFCRTPNPALKNGQYWV
Download sequence
Identical sequences ENSMMUP00000021185 9544.ENSMMUP00000021185 ENSMMUP00000021185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]