SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021314 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021314
Domain Number 1 Region: 647-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.93e-59
Family Protein kinases, catalytic subunit 0.0000000675
Further Details:      
 
Domain Number 2 Region: 18-210
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.35e-55
Family Ephrin receptor ligand binding domain 0.00000518
Further Details:      
 
Domain Number 3 Region: 350-563
Classification Level Classification E-value
Superfamily Fibronectin type III 7.62e-33
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 4 Region: 929-1000
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.25e-17
Family SAM (sterile alpha motif) domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021314
Domain Number - Region: 280-343,389-409
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000283
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021314   Gene: ENSMMUG00000016218   Transcript: ENSMMUT00000022788
Sequence length 1003
Comment pep:known chromosome:MMUL_1:3:180504960:180517490:1 gene:ENSMMUG00000016218 transcript:ENSMMUT00000022788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVSVLDDQRRLTRTFEAC
HVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVSGGTCRETFTLYYRQA
EEPDSPESVSSWHLKRWTKVDTIAADESFPSSSSSSSSAAWAVGPHGAGQRAGLQLNVKE
RSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASFPETQASGAGGASLVAA
VGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCLCQPGHQPARGDKACQACP
RGLYKASAGNVPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPPEAPCTGPPSAPQELWF
EVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGGTCRRCRDEVHFDPRQR
GLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVSTSHEVPSAVPVVHQVS
RASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLTSETNTATVTQLSPGHIYGF
QVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILGALAFLLLAAITVLAVV
FQRKRRGTGYMEQLQQYSSPGPGVKYYIDPSTYEDPCQAIRELAREIDPAYIKIEEVIGT
GSFGEVRRGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAVLGQFQHPNILRLEGVV
TKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAAMQYLSSFAFVHRSLSA
HSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTASSDVWSFGILMWEVMSYG
ERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDRARRPHFDQLVAAFDKM
IRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFS
DVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
Download sequence
Identical sequences G7P1G7
ENSMMUP00000021314 9544.ENSMMUP00000021314 ENSMMUP00000021314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]