SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021325 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021325
Domain Number 1 Region: 243-454
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.57e-56
Family Reprolysin-like 0.00046
Further Details:      
 
Domain Number 2 Region: 541-596
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000262
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 3 Region: 1475-1534
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 4 Region: 938-995
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 5 Region: 1422-1475
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 824-882
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000109
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 881-943
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 8 Region: 1363-1427
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000405
Family TSP-1 type 1 repeat 0.0087
Further Details:      
 
Domain Number 9 Region: 1318-1368
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000445
Family TSP-1 type 1 repeat 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021325   Gene: ENSMMUG00000016226   Transcript: ENSMMUT00000022799
Sequence length 1597
Comment pep:known chromosome:MMUL_1:6:33625849:33999539:-1 gene:ENSMMUG00000016226 transcript:ENSMMUT00000022799 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFVKGLPEYHVVGPVRV
DASGHFLSYGLHYPITSSRRRRDLDGSEDWVYYRISHEEKDLFFNLTVNRGFLSNSYIME
KRYGNLSRIKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVK
KHPLVEGGYHPHIVYRRQKVPETKEPTCGLNDSVNISQKQELWREKWERHNLPSRSRSRR
SISKERWVETLVVADTKMIEYHGSENVESYILTIMNMVTGLFHNPSIGNAIHIVVVRLIL
LEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLLTRKDICAGFNRPCET
LGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHPYIMS
RQLQYDPTPLTWSKCSEEYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVHHQCQL
QYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPES
IPGGWGRWSPWSHCSRTCGAGVQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRSEA
PTFRQMQCSEFDTVPYKNELYHWFPIFNPAHPCELYCRPIDGQFSEKMLDAVIDGTPCFE
GGNSRNVCINGICKMVGCDYEIDSNATEDRCGVCLGDGSSCQTVRKMFKQKEGSGYVDIG
LIPKGARDIRVMEIEGAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDRKGDL
EKLMATGPTNESVWIQLLFQVTNPGIKYEYTIQKDGLDNDVEQQMYFWQYGRWTECSVTC
GTGIRRQTAHCIKKGRGMVKATFCDPETQPNGRQKKCHEKACPPRWWAGEWEACSATCGP
HGEKKRTVLCIQTMGSDEQALPPTDCQHLLKPKTLLSCNRDICPSDWTVGNWSECSVSCG
GGVRIRSVTCAKNHDEPCDVTRKPNSRALCGLQQCPSSRRGLKPNKGTISNGKNPPTPEQ
DPVKPVPLPTSRPRMLTTPIGPESMSTSPAAISSPHPTTASKEGDMGGTQWQDSSTQPEL
SSRYLIPTGSTSQPILTSRSVSIQPSEENVSSSDAGPTWEGGLVATTSGSDLSSSRNPMT
WPVTPFYNTLTKGPEMEIHSGSGEDREQPEGKDESNPVIWTKIRVPGNDAPVESTEMPLA
PPLTPDLGGESPWPTFSTVIEGLLPSQRPSTPKTGTPRVEGMVTEKPADTLLPLGRDHQP
EPSGKTANHSHLKLPNDMNQTESTEPVLTEEDATSLIAEGFLLNASNYKQLTNDHGSAHW
IVGNWSECSTTCGLGAYWRRVECSTQMDSDCAAIQRPDPAKRCHLRPCAGWKVGNWSKCS
RNCSGGFKIREIQCVDSRDHRNLRPFHCQFLAGIPPPLSMSCNPEPCGVWQVEPWSQCSR
SCGGGVQEREVFCPGGLCDWTKRPTSTMSCNEHLCCHWATGNWELCSTSCGGGFQKRTVH
CVPSENNKTEDQDQCLCDHEPRPPEFKKCNQQACKKSADLLCTKDKLSASFCQTLKAMKK
CSVPTVRAQCCFSCPQTHITHSQRQRRQRLPQKPKAL
Download sequence
Identical sequences 9544.ENSMMUP00000021325 ENSMMUP00000021325 ENSMMUP00000021325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]