SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021364 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021364
Domain Number 1 Region: 232-381,431-581,646-669
Classification Level Classification E-value
Superfamily TROVE domain-like 3.14e-62
Family TROVE domain-like 0.0059
Further Details:      
 
Domain Number 2 Region: 2055-2391
Classification Level Classification E-value
Superfamily WD40 repeat-like 6.72e-57
Family WD40-repeat 0.00022
Further Details:      
 
Domain Number 3 Region: 1670-1912
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.51e-49
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 4 Region: 1880-2094
Classification Level Classification E-value
Superfamily WD40 repeat-like 8.06e-33
Family WD40-repeat 0.0025
Further Details:      
 
Domain Number 5 Region: 2324-2399,2459-2500,2547-2620
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000000000439
Family WD40-repeat 0.014
Further Details:      
 
Domain Number 6 Region: 1147-1335
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000491
Family Extended AAA-ATPase domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021364   Gene: ENSMMUG00000016255   Transcript: ENSMMUT00000022840
Sequence length 2621
Comment pep:known chromosome:MMUL_1:7:83071278:83113813:-1 gene:ENSMMUG00000016255 transcript:ENSMMUT00000022840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KKPHGHVSAHPDILSLEKRCLAMLPDLQPMKKLHQHISAHSDILSLKNQCLATLPDLKTV
EKPHGYVSAHPDILSLENRCLATLSDLKTMEKPHGHVSAHPDILSLENRCLATLPSLKST
VSASRLFQSLQISHMTQADLYCVNNSNCLLSEPPSWSAQHFSKGLDLSTCPTALKSLSAT
GTVQEATLGRWFDSEEKKGAETQMPSYSLSLGEEEEEVEDLALKLTSGDSESHPEPTDQV
LQEKKMALLSLLCSTLVSEVNMKDASDPTLAAIFENCRELAPLEPEFILKASLYARQQLN
VRNVANKILAIAAFLPACRPHLRRYFCAIVQLPSDWIQVAELYQSLAEGDENKLVPLPAC
LRAAMTDKFAQFDEYQLAKYNPRKHRAKRHPRRPPRSPRMEPPFSRRPFPRYIVFLRDEQ
KKFEKAYDTVSEKKNPPRFTLKKLVQRLHIHEPAQHVQALLGYRYPSNLQLFSRSRLPGP
WDSSRAGKRMKLSRPETWERELSLRGNKASVWEELIENGKLPFMAMLRNLCNLLRVGISA
RHHELILQRLQHAKSVIHSRQFPFRFLNAHDSIDALEAQLRNQALPFPSNTTLMRRILTR
SDKNRPRRRFLCHLSCQQLRTVMRVPVMYEKLKREKLRVHKARQWKYDGEMLNRYRQALE
TAVNLSVKHSLPLLPGRTILVYLTDANADRLCPKSNPQGPPLNYALLLIGMMITRAEQVD
VMLCGGDTLKTAVLKAEEGILKTAIRLQAQVQEFDENGEWSLNTFGKYLLSLAGQRVPAD
RVILFGQSMDEGMINVAKQLYWQHVNSKCLFVGVLLRRVQYLSPDLNPNDVTLSGCTDGI
LKFIAEHGASHLLEHVGQMDKIFKIPPPPGKTGVQSLRPLEEDTPSPLAPISQQGWRSIR
LFISSTFRDMHGERDLLLRSVLPALQARAAPHRISLHGIDLRWGVTEEETRRNRQLEVCL
GEVENAQLFVGILGSRYGYIPPSYNLPDHPHFHWAQQYPSGRSVTEMEVMQFLNRSQRLQ
PSAQALIYFRDSSFLSSVPDAWKSDFVSESEEAACRISELKSCLSRQKGITCRRYPCEWG
GVAAGRPYVGGLEEFGQLVLQDVWNTIQKLYLQPGALLEQPVSIPDDDLVQATFQQLQKP
PSTARPRLLQDTVQQLMLHHGRLSLVTGQSGQGKTAFLASLVSALQAPDGAKVAPLVFFH
FSGARPDQGLALTLLRRLCTYLRGQLKEPGALPNTYRSLVWELQQRLLPKSAESLHPGQT
LVLIIDGADRLVDQNGQLISDWIPKKLPRCVHLVLSVSRDAGLGETLEQSQGAHVVALGP
LEASARARLVREELALYGKRLEESPFNNQVGKLWFLIMSPSPLPLALPVSMSRSVLLTFQ
VSERLRTLPATVPLLLQHILSTLEQEHGPDVLPQALTALEVTRSGLTVDQLHGVLSVWRT
LPKGTKSWEEAVAAGNSGDPYPMGPFAYLVQSLRSLLGEGPLERPGARLCLPDGPLRTAA
KRRYGKRPGQEDTAHILIAAQLWKTCDADASGTFRSCPPEALVDLPYHLLQSGNRGLLSK
FLTNIHVVAAHLELGLVSRLLETHALYASSVPKEEQKLPEADVTVFRTFLRQQASILSQY
PQLLPQQAANQPLDSPLCQQAPLLSQRWHLQHTLRWLNKPQTMKNQQSSSLSLAVSSSPT
AVAFSTNGQRAAVGTANGTVYLLDLRTWQEEKSLVSGCDGISACLFLSDDTLFLTAFDGL
LELWDLQHGCRVLQTKAHQYQITGCCLSPDRRLLATVCLGGCLKLWDTVRGQLAFQHTYP
KPLNCVAFHPEGQVIATGSWAGSISFFQVDGLKVTKDLGAPGASVRTLAFNVPGGVVAVG
RLDSMVELWAWREGARLAAFPAHHGFVAAALFLHAGCQLLTAGEDGKVHVWSGSLGRPRG
DLGSLPLSPALSVALSPDGDRVAVGYRADGIRIYKISSGSQGAQGQALDVAVSALAWLSP
KVLVSGAEDGSLQGWALKECSLQSLWLLSRFQKPVLGLATSQELLASASEDFTVRLWPRQ
LLTLPHKAEDFPGGTELRGHEGPVSCCSFSTDGGSLATGGRDRSLLCWDVRTPKAPILIH
SFPACHRDWVTGCAWTKDNLLISCSSDGSVGLWDPESGQRLGQFLGHQSAVSAVAAVEEH
VVSVGRDGTLKVWDHQGVELTSIPAHSGPISHCAAAMEPRAAGQPGSELLVVTIGLDGAT
RLWHPLLVSQTHTFLGHSGPVRAAAVSETSGLLLTASEDGSVRLWQVPKEADDTCIPRSS
AAITAMAWAPDGSMAVSGNQAGELILWQEAKAVATAQAPGHIGALIWSSARTFFVLSADE
KISEWQVKLRKGSAPGNFSLHLNRILQEDLGVLTSLGWAPDGHFLILAKADLKLLCMKPG
DAPSEIWSSYTENPMILSTHKEYGVFVLQPKDPGVLSFLRQKESGEFEERLNFDINLENP
SRTLISITQAKPESESSFLCASSDGMLWNLAKCSPEGEWTTGNIWQKKANIPETQTPGAD
PSTCRESDASMDSEPTSQLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMQ
LLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE
Download sequence
Identical sequences ENSMMUP00000021364 9544.ENSMMUP00000021364 ENSMMUP00000021364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]