SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021375 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021375
Domain Number 1 Region: 11-105
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 0.0000000000218
Family Thioesterase domain of polypeptide, polyketide and fatty acid synthases 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021375   Gene: ENSMMUG00000016267   Transcript: ENSMMUT00000022853
Sequence length 181
Comment pep:known chromosome:MMUL_1:9:15341830:15355866:1 gene:ENSMMUG00000016267 transcript:ENSMMUT00000022853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRGDQAKRTRNEKVFNCLYKNPEATFKLICFPWVAGGSVHFAKWGQDTHDSLEVHSLRL
PGRESRIEEPFANDISQLVDEVVCALQPVIQEKPFAFFGHRMGSVYIAFKKYIYMKFTNK
QPLAVLSNKFTCFKSKAWPRIPKEDELSEEQIHHYLKEFGGTPKDFVEEKELVQQYKPMI
M
Download sequence
Identical sequences 9544.ENSMMUP00000021376 ENSMMUP00000021375 ENSMMUP00000021376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]