SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021384 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021384
Domain Number 1 Region: 281-469
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.35e-38
Family SPRY domain 0.00016
Further Details:      
 
Domain Number 2 Region: 7-81
Classification Level Classification E-value
Superfamily RING/U-box 4.24e-18
Family RING finger domain, C3HC4 0.0051
Further Details:      
 
Domain Number 3 Region: 75-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000147
Family B-box zinc-binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021384   Gene: ENSMMUG00000016276   Transcript: ENSMMUT00000022863
Sequence length 477
Comment pep:known chromosome:MMUL_1:20:29315033:29325260:1 gene:ENSMMUG00000016276 transcript:ENSMMUT00000022863 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAAPGLLHQELSCPLCLQLFDAPVTAECGHSFCRACLGRVAGEPAADGTVLCPCCQAPT
RPQALSTNLQLARLVEGLAQVPQGHCEEHLDPLSIYCEQDRALVCGVCASLGSHRGHRLL
PAAEAHARLKTQLPQQKLQLQEACMRKEKSVAVLEHQLVEVEETVRQFRGAVGEQLGKMR
VFLAALEGSLDREAERVRGEAGVALRRELGSLNSYLEQLRQMEKVLEEVADKPQTEFLMK
YCLVTSRLQKILAESPPPARLDIQLPIISDDFKFQVWRKMFRALMPALEELTFDPSSAHP
SLVVSSSGRRVECSEQKAPPAGEDPRQFDKAVAVVAHQQLSEGEHYWEVEVGDKPRWALG
VIAAEGPRRGRLHAVPSQGLWLLGLREGKILEAHVEAKEPRALRSPERRPTRIGLYLSFG
DGVLSFYDASDADALVPLFAFHERLPGPVYPFFDVCWHDKGKNSQPLLLVGSEGAEA
Download sequence
Identical sequences A0A1D5QU02 A0A2K5VAF6
XP_005591794.1.63531 XP_014981480.1.72884 9544.ENSMMUP00000021384 ENSMMUP00000021384 ENSMMUP00000021384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]