SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021385 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021385
Domain Number 1 Region: 382-539,582-745
Classification Level Classification E-value
Superfamily WD40 repeat-like 7.69e-47
Family WD40-repeat 0.007
Further Details:      
 
Domain Number 2 Region: 710-757,784-860
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000000247
Family Quinoprotein alcohol dehydrogenase-like 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021385
Domain Number - Region: 281-390
Classification Level Classification E-value
Superfamily Galactose oxidase, central domain 0.0994
Family Galactose oxidase, central domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021385   Gene: ENSMMUG00000016277   Transcript: ENSMMUT00000022864
Sequence length 975
Comment pep:known chromosome:MMUL_1:13:42353464:42436699:1 gene:ENSMMUG00000016277 transcript:ENSMMUT00000022864 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IDDSISAASTSDVQDRLSALESRVQQQEDEITVLKAALADVLRRLAISEDHVASVKKSVS
SKGQPSPRAAIPMSCITNGSGANRKPSHTSTVSIAGKETLSSAAKSGTEKKKEKPQGQRE
KKEESHSNDQSPQIRASPSPQPSSQPLQIHRQTPESKNATPTKSIKRPSPAEKSHNSWEN
SDDSRNKLSKIPSTPKLIPKVTKNTDKHKDVIINQEGEYIKMFMRGRPITMFIPSDVDNY
DDIRTELPSEKLKLEWAYPSLHDSKFICFVSSLTNYLTYSLSKLSLYKKKKKSNSYLKEH
HARRGGSRCLAIHPDKIRIATGQIAGVDKDGRPLQPHVRVWDSVTLSTLQIIGLGTFERG
VGCLDFSKADSGVHLCVIDDSNEHMLTVWDWQKKAKGAEIKTTNEVVLAVEFHPTDANTI
ITCGKSHIFFWTWSGNSLTRKQGIFGKYEKPKFVQCLAFLGNGDVLTGDSGGVMLIWSKT
TVEPTPGKGPKGVYQISKQIKAHDGSVFTLCQMRNGMLLTGGGKDRKIILWDHDLNPERE
IEVPDQYGTIRAVAEGKADQFLVGTSRNFILRGAFNDGFQIEVQGHTDELWGLATHPFKD
LLLTCAQDRQVCLWNSMEHRLEWTRLVDEPGHCADFHPSGTVVAIGTHSGRWFVLDAETR
DLVSIHTDGNEQLSVMRYSIDGTFLAVGSHDNFIYLYVVSENGRKYSRYGRCTGHSSYIT
HLDWSPDNKYIMSNSGDYEILYWDIPNGCKLIRNRSDCKDIDWTTYTCVLGFQVFGVWPE
GSDGTDINALVRSHNRKVIAVADDFCKVHLFQYPCSKAKAPSHKYSAHSSHVTNVSFTHN
DSHLISTGGKDMSIIQWKLVEKLSLPQNETVADTTLTKAPVSSTESVIQSDTPTPPPSQS
LNETAEEESRISSSPTLLENSLEQTVEPSEDHSEEESEGGSGDLGEPLYEEPSNEISKQG
EATLPEDQQDPLPSS
Download sequence
Identical sequences ENSMMUP00000021385 ENSMMUP00000021385 9544.ENSMMUP00000021385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]