SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021457 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000021457
Domain Number - Region: 151-294
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0309
Family TTHA0179-like 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021457   Gene: ENSMMUG00000016338   Transcript: ENSMMUT00000022942
Sequence length 363
Comment pep:known chromosome:MMUL_1:3:119141710:119152205:-1 gene:ENSMMUG00000016338 transcript:ENSMMUT00000022942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEQGDIQPNVLHNDPHARHSDDNGQNHLE
GEMNFNADSSQHKDENTDIAENLYQKVKILCWVMTGPQNLEKKAKHVKATWAQRCNKVLF
MSSEENKDFPAVGLKTKEGRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLR
WLLSKYDPEEPIYFGRRFKPYVKQGYMSGGAGYVLSKEALKRFVDAFKTDKCTHSSSIED
LALGRCMEIINVEAGDSRDTTGKETFHPFVPEHHLIKGYLPRTFWYWNYNYYPPVEGPGC
CSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPEDILKEISQANKKEDTKVKL
GNP
Download sequence
Identical sequences F7GRL3
ENSMMUP00000021457 9544.ENSMMUP00000021457 ENSMMUP00000021457 XP_011729228.1.29376 XP_011729230.1.29376 XP_011729231.1.29376 XP_011830109.1.47321 XP_014989517.1.72884 XP_014989518.1.72884 XP_014989519.1.72884 XP_015303195.1.63531 XP_015303196.1.63531 XP_015303197.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]