SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021468 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021468
Domain Number 1 Region: 133-202
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.44e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021468   Gene: ENSMMUG00000016347   Transcript: ENSMMUT00000022955
Sequence length 347
Comment pep:known chromosome:MMUL_1:3:153313526:153383468:-1 gene:ENSMMUG00000016347 transcript:ENSMMUT00000022955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILDHQIINPALKWSQPTVPSGGPLVQQAHTTLDSDAGLSENPLTKLLTLGKEDDNAQWH
MEDVIEDIIGMESSFKEEGADSPLLMQRTLSGSILDVYSGEQGISPINMGLTSAFCPSSL
PMKREITETDTRALAKERQKKDNHNLIERRRRYNINYRIKELGTLIPKSNDPDMRWNKGT
ILKASVEYIKWLQKEQQRARELEHRQKKLEQANRRLLLRIQELEIQARTHGLPTLASLGT
VDLGAHVTKQQSHPEQNSVDYCQQLTVSQGPTPELCDQAIAFSDPLSYFTDLSFSAALKE
EQRLDGMLLDDTISPFGTDPLLSATSPAVSKESSRRSSFSSDDGDEL
Download sequence
Identical sequences ENSMMUP00000021468 ENSMMUP00000021468 9544.ENSMMUP00000021468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]