SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021489 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021489
Domain Number 1 Region: 8-254
Classification Level Classification E-value
Superfamily SAICAR synthase-like 2.94e-64
Family SAICAR synthase 0.00012
Further Details:      
 
Domain Number 2 Region: 265-420
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 8.5e-40
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021489   Gene: ENSMMUG00000016366   Transcript: ENSMMUT00000022977
Sequence length 421
Comment pep:known chromosome:MMUL_1:5:72918773:72938751:-1 gene:ENSMMUG00000016366 transcript:ENSMMUT00000022977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FISTVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKIT
SCIFQLLQEAGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKF
YPPKVELFFKDDANNDPQWSEEQLIAAKLCFAGLVIGQTEVDIMSHATQAIFEILEKSWL
PQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYDLKEVTPERL
QMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSA
HKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGAQDV
WSSLRLPSGLGCSTILSPEGSAQFAAQIFGLNNHLVWSKLRASILNTWISLKQADKKIRE
C
Download sequence
Identical sequences 9544.ENSMMUP00000021489 ENSMMUP00000021489 ENSMMUP00000021489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]