SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021546 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021546
Domain Number 1 Region: 55-295
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000000000253
Family Spore coat polysaccharide biosynthesis protein SpsA 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021546   Gene: ENSMMUG00000016405   Transcript: ENSMMUT00000023035
Sequence length 626
Comment pep:known chromosome:MMUL_1:1:186618742:186722534:1 gene:ENSMMUG00000016405 transcript:ENSMMUT00000023035 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARPAATLAWSLLLLSSALLREGCRARFAAEPDSEDDGEEPVVFPESPLQSPTVLVAVL
ARNAAHTLPHFLGCLERLDYPKSRMAIWAATDHNVDNTTEILREWLKNVQRLYHYVEWRP
MDEPESYPDEIGPKHWPSSRFAHVMKLRQAALRTAREKWSDYILFIDVDNFLTNPQTLNL
LIAENKTIVAPMLESRGLYSNFWCGITPKGFYKRTPDYVQIREWKRSGCFPVPMVHSTFL
IDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYLCNREHYGYLPIPLKSHQ
TLQEDIENLIHVQIEAMIDRPPMEPSKYVSLVPKYPDKMGFDEIFMINLKRRKDRRDRML
RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEIGCFLSHYSV
WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDDIDQAQLDWELIYIGRKRMQVKEPEK
AVPNVANLVEADYSYWTLGYVISLEGAQKLVGADPFGKMLPVDEFLPIMYNKHPVAEYKE
YYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSR
IYSSAKNTEALPPPTSLDTVPSRDEL
Download sequence
Identical sequences A0A2K5NGE0 A0A2K5UAQ2
ENSMMUP00000021546 ENSMMUP00000021546 9544.ENSMMUP00000021546 XP_005540276.1.63531 XP_011903264.1.92194 XP_014977511.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]