SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021644 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021644
Domain Number 1 Region: 108-173
Classification Level Classification E-value
Superfamily Chromo domain-like 2.23e-27
Family Chromo domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 13-76
Classification Level Classification E-value
Superfamily Chromo domain-like 1.88e-23
Family Chromo domain 0.0000494
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021644   Gene: ENSMMUG00000016472   Transcript: ENSMMUT00000023136
Sequence length 185
Comment pep:known chromosome:MMUL_1:14:41635041:41635598:-1 gene:ENSMMUG00000016472 transcript:ENSMMUT00000023136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDC
PDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPE
QIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSHPSEDDDK
KDDEN
Download sequence
Identical sequences ENSMMUP00000021644 ENSMMUP00000021644 9544.ENSMMUP00000021644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]