SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021732 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021732
Domain Number 1 Region: 68-305
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 3.37e-38
Family Haloperoxidase 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021732   Gene: ENSMMUG00000016539   Transcript: ENSMMUT00000023229
Sequence length 310
Comment pep:known chromosome:MMUL_1:19:1651425:1752001:-1 gene:ENSMMUG00000016539 transcript:ENSMMUT00000023229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPESGPGGAGAAPLGTLRASS
GAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNRVSCMYVRCVPGARYTVLFSHGN
AVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGIS
PDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKV
SKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRF
ISQELPSQRA
Download sequence
Identical sequences A0A0A0MVL7 A0A2K5ILS8 A0A2K5KIC4 A0A2K6AXV1 F6WC85
ENSMMUP00000021732 NP_001253959.1.72884 XP_011746940.1.29376 XP_011928329.1.92194 XP_011928330.1.92194 XP_014977864.1.72884 9544.ENSMMUP00000021732 ENSMMUP00000021732 ENSPANP00000007057

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]