SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021751 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021751
Domain Number 1 Region: 119-265
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-39
Family Pleckstrin-homology domain (PH domain) 0.00016
Further Details:      
 
Domain Number 2 Region: 53-88
Classification Level Classification E-value
Superfamily WW domain 0.00000000475
Family WW domain 0.0023
Further Details:      
 
Domain Number 3 Region: 9-45
Classification Level Classification E-value
Superfamily WW domain 0.0000000193
Family WW domain 0.004
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000021751
Domain Number - Region: 713-738
Classification Level Classification E-value
Superfamily Bacillus phage protein 0.0732
Family Bacillus phage protein 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021751   Gene: ENSMMUG00000016550   Transcript: ENSMMUT00000023248
Sequence length 906
Comment pep:known chromosome:MMUL_1:11:19513353:19736559:1 gene:ENSMMUG00000016550 transcript:ENSMMUT00000023248 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADLNLEWISLPRSWTYGITRGGRVFFINEEAKSTTWLHPVTGEAVVTGHRRQSTDLPT
GWEEAYTFEGARYYINHNERKVTCKHPVTGQPSQDNCIFVVNEQTVATMTSEEKKERPIS
MINEASNYNVTSDYAVHPMSPVGRTSRASKKVHNFGKRSNSIKRNPNAPVVRRGWLYKQD
STGMKLWKKRWFVLSDLCLFYYRDEKEEGILGSILLPSFQIALLTSEDHINRKYAFKAAH
PNMRTYYFCTDTGKEMELWMKAMLDAALVQTEPVKRVDKITSENAPTKESNNIPNHRVLI
KPEIQNNQKNKEMSKIEEKKALEAEKYGFQKDGQDRPLTKINSVKLNSLPSEYESGSACP
AQTAHYRPVNLNSSENKIVNVSLADLRGGNRPSTGPLYTEADRVIQRTNSMQQLEQWIKI
QKGRGHEEETRGVISYQTLPRNMPSHRAQIMARYPEGYRTLPRNSKTRPESICSVAPSTH
DKTLGPGAEEKRRSMRDDTMWQLYEWQQRQFYNKQSTLPRHSTLSSPKTMVNISDQTMHS
IPTSPSHGSIAAYQGYSPQRTYRSEVSSPIQRGDVTIDRRHRAHHPKHVYVPDRRSVPAG
LTLQSVSPQSLQGKTLSQDEGRGTLYKYRPEEVDIDAKLSRLCEQDKVVHALEEKLQQLH
KEKYTLEQALLSASQEIEMHADNPAAIQTVVLQRDDLQNGLLSTCRELSRATAELERAWR
EYDKLEYDVTVTRNQMQEQLDHLGEVQTESAGIQRAQIQKELWRIQDVMEGLSKHKQQRG
TTEIGMVGSKPFSTVKYKSEEEEVVPPRPPLPWSYDFTEQPPIIPPLPSDSSSLLCYSRG
PVHLPEEKKMYQVQGYPRNGSHCGPDYRLYKSEPELTTVAEVDESNGEEKSEPVSEIETS
VVKGQH
Download sequence
Identical sequences ENSMMUP00000040130 ENSMMUP00000021751 9544.ENSMMUP00000040130

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]