SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000021910 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000021910
Domain Number 1 Region: 277-464
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-65
Family SPRY domain 0.0000075
Further Details:      
 
Domain Number 2 Region: 5-85
Classification Level Classification E-value
Superfamily RING/U-box 9.66e-21
Family RING finger domain, C3HC4 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000021910   Gene: ENSMMUG00000016660   Transcript: ENSMMUT00000023415
Sequence length 468
Comment pep:known chromosome:MMUL_1:5:180278783:180287068:1 gene:ENSMMUG00000016660 transcript:ENSMMUT00000023415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTADLMENLREELTCFICLDYFSSPVTTECGHSFCLVCLLRSWEEHNTPLSCPECWRTL
EGPHFQPNERLGRLASIARQLRSQVLQSEDEQSSYGRMPAAAKALSDDEQGGSVFAVQSH
GVNRVHLSSEAEEHHREKLQEILNLLCIRRKEAQAVLTHEKERVKLCQEETKTCKQVVVS
EYMKMHQFLKEEEQLQLQLLEQEERENMRKLRNNEIKLTQQIRGLSKMIGQMESSSQSSA
LESLEEVRGALERSEPLLLQCPEATTTELSLCRITGMKEMLRKFSTEITLDPATANAYLV
LSEDLKSVKYGGSRQQLPDNPERFDQSATVLGAQIFTSGRHYWEVEVGNKTEWEVGICKD
SVSRKGNLPKPPGDLFSLIGLKIGDDYSLWVSSPLKGQHVREPVCKVGVFLDYESGHIAF
YNGTDESLIYSFPPASFQEALRPIFSPCLPNEGTNTDPLTICSLNSHV
Download sequence
Identical sequences A0A2K5YPH2 F6W0V1 G7P6Q0
9544.ENSMMUP00000021910 ENSMMUP00000021910 XP_014995150.1.72884 XP_014995151.1.72884 ENSMMUP00000021910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]