SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022041 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022041
Domain Number 1 Region: 120-439
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 1.75e-63
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000594
Further Details:      
 
Domain Number 2 Region: 447-586
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.4e-32
Family Ricin B-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022041   Gene: ENSMMUG00000016767   Transcript: ENSMMUT00000023558
Sequence length 601
Comment pep:known chromosome:MMUL_1:5:163897276:165098963:1 gene:ENSMMUG00000016767 transcript:ENSMMUT00000023558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRKQKRFLQMTLLFTVALIFLPNIGLWSLYKDKHLVKSAEPGEQQTFPLGLGDGQFYSW
TDGLRRKDWHDYESIQKEAMRSGKGEHGKPYPLTEEDHDDSAYRENGFNIFVSNNIALER
SLPDIRHANCKHKMYLERLPNTSIIIPFHNEGWTSLLRTIHSIINRTPESLIAEIILVDD
FSEREHLKDKLEEYMARFSKVRIVRTKKREGLIRTRLLGASMARGEVLTFLDSHCEVNVN
WLPPLLNQIALNHKTIVCPMIDVIDHNHFGYEAQAGDAMRGAFDWEMYYKRIPIPPELQR
ADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGEMFDVPC
SRVGHIYRKYVPYKVPSGTSLARNLKRVAETWMDEFAEYIYQRRPEYRHLSTGDISAQKE
LRKQLKCKDFKWFMAAVAWDVPKYYPPVEPPPAAWGEIRNVAANLCVDSKHGATGTELRL
DICVKDGSERTWSHEQLFTFGWREDIRPGEPLHTRKFCFDAISHNSPVTLYDCHGMKGNQ
LWGYRKDRTLFHPVSNSCMDCNPAEKKIFMARCDPLSETQQWIFEHINMTVLEKFNHHAS
S
Download sequence
Identical sequences A0A2K5M971 A0A2K5W9R7 A0A2K6A7X1 A0A2K6D6M3 F7DBP1
9544.ENSMMUP00000022041 ENSMMUP00000022041 XP_001084788.1.72884 XP_007998457.1.81039 XP_011714057.1.29376 XP_011841483.1.47321 XP_011941769.1.92194 XP_015306520.1.63531 ENSMMUP00000022041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]