SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022046 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022046
Domain Number 1 Region: 224-314
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 1.83e-24
Family SWIB/MDM2 domain 0.0000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022046   Gene: ENSMMUG00000016771   Transcript: ENSMMUT00000023563
Sequence length 454
Comment pep:known chromosome:MMUL_1:16:59345641:59351134:-1 gene:ENSMMUG00000016771 transcript:ENSMMUT00000023563 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPGNRMPMRLAGGTPCWLPIWCSSSASTWHATHHDGSIPKTPACAPQPPMPAQRRGLKR
RKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEIQEAIKKPLTQKRKLRIY
ISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLDDPSKQKRKFSSFFKSLV
IELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTLLLMLDHQPPQYKLDPRL
ARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFRQIFSCGRLRFSEIPMKL
AGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQMSNFLASTTNQQEIASLD
VKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAF
YHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT
Download sequence
Identical sequences ENSMMUP00000022046 ENSMMUP00000022046 9544.ENSMMUP00000022046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]