SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022071 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022071
Domain Number 1 Region: 246-663
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 2.3e-88
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00043
Further Details:      
 
Domain Number 2 Region: 108-244
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 1.76e-37
Family Ferredoxin domains from multidomain proteins 0.00024
Further Details:      
 
Domain Number 3 Region: 32-107
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.1e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022071   Gene: ENSMMUG00000016788   Transcript: ENSMMUT00000023589
Sequence length 730
Comment pep:known chromosome:MMUL_1:12:70002266:70033849:-1 gene:ENSMMUG00000016788 transcript:ENSMMUT00000023589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRIPVRKALVGLSKSPKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKKSQVVAACAMPVMKGWNILTNSEKSKKAREGVM
EFLLANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCI
QCTRCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYA
FTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGL
KRQRLTEPMIRNEKGLLTYTSWEDALSRVAGMLQSFQGKDVAAIAGGLVDAEALVALKDL
LNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNAR
IRKRFLRTDLNIFFVNSVTFIKNSFFFFFLSLRLLKTISLNYSHFLEVLKEAKKPMVVLG
SSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAI
RKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYV
NTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYD
DIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEG
AQAVEEPSIC
Download sequence
Identical sequences 9544.ENSMMUP00000022071 ENSMMUP00000022071 ENSMMUP00000022071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]