SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022117 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022117
Domain Number 1 Region: 236-456
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.63e-57
Family Reprolysin-like 0.0003
Further Details:      
 
Domain Number 2 Region: 546-601
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000209
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 3 Region: 888-944
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000353
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 4 Region: 825-884
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 1001-1054
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000034
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 6 Region: 943-1002
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000497
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022117   Gene: ENSMMUG00000016821   Transcript: ENSMMUT00000023636
Sequence length 1103
Comment pep:known chromosome:MMUL_1:19:8567274:8593558:-1 gene:ENSMMUG00000016821 transcript:ENSMMUT00000023636 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPACQILRWALALGLGLMFEVTHAFRSQDEFLSSLESYEIAFPTRVDHNGALLAFSPPP
PRRQRRGTGATAESRLFYKVASPSTHFLLNLTRSSRLLAGHVSVEYWTREGLAWQRAARP
HCLYAGHLQGQASSSHVAISTCGGLHGLIVADEEEYLIEPLHGGPKGSRGPEESGPHVVY
KRSSLRHPHLDTACGVRDEKPWKGRPWWLRTLKPPPARPLGNETERGQPGLKRSVSRERY
VETLVVADKMMVAYHGRRDVEQYVLAIMNIVAKLFQDSSLGSTVNILVTRLILLTEDQPT
LEITHHAGKSLDSFCKWQKSIVNHSGHGNAIPENGVANHDTAVLITRYDICIYKNKPCGT
LGLAPVGGMCERERSCSVNEDIGLATAFTIAHEIGHTFGMNHDGVGNSCGARGQDPAKLM
AAHITMKTNPFVWSSCSRDYITSFLDSGLGLCLNNRPPRQDFVYPTVAPGQAYDADEQCR
FQHGVKSRQCKYGEVCSELWCLSKSNRCITNSIPAAEGTLCQTHTIDKGWCYKRVCVPFG
SRPEGVDGAWGPWTPWGDCSRTCGGGVSSSSRHCDSPRPTIGGKYCLGERRRHRSCNTDD
CPPGSQDFREMQCSEFDSIPFRGKFYTWKTYRGGGVKACSLTCLAEGFNFYTERAAAVVD
GTPCRPDTVDICVSGECKHVGCDRVLGSDVREDKCRVCGGDGSACETIEGVFSPASPGAG
YEDVVWIPKGSVHIFIQDLNLSLSHLALKGDQESLLLEGLPGTPQPHRLPLAGTTFQLRQ
GPDQFQSLEALGPINASLIVMVLARTELPALRYRFNAPITRDSLPPYSWHYAPWTKCSAQ
CAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPKRQRACNTEPCPPDWVVGNWSRCSRSC
DAGVRSRSVVCQRRVSAAEEKALDDSACPQPRPPVLEACHGPTCPPEWAALDWSECTPSC
GPGLRHRVVLCKSADHRATLPPAHCSPAAKPPATMRCNLRRCPPARWVAGEWGECSAQCG
LGQQQRSVRCTSHTGQASHECTEALRPPTTQQCEAKCDSPTPGDSPEECKDVNKVAYCPL
VLKFQFCSRAYFRQMCCKTCQGH
Download sequence
Identical sequences A0A2K5TQJ2 A0A2K6DGE8 I2CU91
NP_001252561.1.72884 XP_005587902.1.63531 XP_011740075.1.29376 XP_011740145.1.29376 XP_014978235.1.72884 XP_014978236.1.72884 ENSMMUP00000022117 9544.ENSMMUP00000022117 ENSMMUP00000022117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]