SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022124 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022124
Domain Number 1 Region: 170-245
Classification Level Classification E-value
Superfamily UBA-like 2.27e-18
Family UBA domain 0.0024
Further Details:      
 
Domain Number 2 Region: 281-331
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000836
Family UBA domain 0.015
Further Details:      
 
Domain Number 3 Region: 8-92
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000348
Family Ubiquitin-related 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022124   Gene: ENSMMUG00000016827   Transcript: ENSMMUT00000023643
Sequence length 407
Comment pep:known chromosome:MMUL_1:15:2357154:2387172:1 gene:ENSMMUG00000016827 transcript:ENSMMUT00000023643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFVQEEKIFAGKVLRLHICASDGAEWLEEATEDTSVEKLKERCLKHCAHGSLEDPKSITH
HKLIHAASERVLSDARTILEENIQDQGKAALVKMRAPCRILVPQLGPHRRPEKKKQDQKA
PDKEAILRATANLPSYNMDRAAVQTNMRDFQTELRKILVSLIEVAQKLLALNPDAVELFK
KANAMLDEDEDERVDEAALRQLTEMGFPENRATKALQLNHMSVPQAMEWLIEHAEDPTID
TPLPGQAPSGAEGATAAAPEAAAGAGTADEEARDELTEIFKKIRRKREFRADARAVISLM
EMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQL
GLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
Download sequence
Identical sequences ENSMMUP00000022124 9544.ENSMMUP00000022124 ENSMMUP00000022124

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]