SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022163 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022163
Domain Number 1 Region: 1-356
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 6.1e-72
Family Gastric lipase 0.000000000374
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022163   Gene: ENSMMUG00000016858   Transcript: ENSMMUT00000023685
Sequence length 361
Comment pep:known chromosome:MMUL_1:9:88300882:88329154:1 gene:ENSMMUG00000016858 transcript:ENSMMUT00000023685 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISYWGYPCEEYDVTTKDGYILGIYRIPHGRGCPGRTAPKPAVYLQHGLIASASNWICNLP
NNSLAFLLADSGYDVWLGNSRGNTWSRKHLKLSPESPEYWAFSLDEMAKYDLPATISFII
EKTGQKRLYYVGHSQGTTIAFIAFSTNPELAKRIKIFFALAPVVTLKYTRSPMKKLTTLS
RQVVKVLFGDKMFHPHTLFDKFIATKVCSRKLFHRICSNFLFTLSGFDPQNLNMSRLDVY
LSHNPAGTSVQNMLHWAQAVNSGRLQAFDWGNSDQNMMHFHQLTPPLYNITKMEVPTAIW
NGGQDIVADPKDVKNLLPQIANLIYYKLIPHYNHVDFYLGEDAPQEIYQDLIRLMEAYLK
N
Download sequence
Identical sequences 9544.ENSMMUP00000022163 ENSMMUP00000022163 ENSMMUP00000022163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]