SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000022201 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000022201
Domain Number 1 Region: 5888-6008
Classification Level Classification E-value
Superfamily PH domain-like 9.66e-31
Family Pleckstrin-homology domain (PH domain) 0.00077
Further Details:      
 
Domain Number 2 Region: 5685-5878
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-29
Family DBL homology domain (DH-domain) 0.00042
Further Details:      
 
Domain Number 3 Region: 4515-4628
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-23
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 5120-5216
Classification Level Classification E-value
Superfamily Immunoglobulin 1.98e-23
Family I set domains 0.006
Further Details:      
 
Domain Number 5 Region: 9-99
Classification Level Classification E-value
Superfamily Immunoglobulin 4.74e-22
Family I set domains 0.004
Further Details:      
 
Domain Number 6 Region: 6010-6110
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-21
Family I set domains 0.0067
Further Details:      
 
Domain Number 7 Region: 6104-6202
Classification Level Classification E-value
Superfamily Immunoglobulin 2.31e-20
Family I set domains 0.0097
Further Details:      
 
Domain Number 8 Region: 239-332
Classification Level Classification E-value
Superfamily Immunoglobulin 2.94e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 9 Region: 108-201
Classification Level Classification E-value
Superfamily Immunoglobulin 2.07e-19
Family I set domains 0.0084
Further Details:      
 
Domain Number 10 Region: 2639-2732
Classification Level Classification E-value
Superfamily Immunoglobulin 2.53e-19
Family I set domains 0.032
Further Details:      
 
Domain Number 11 Region: 5260-5360
Classification Level Classification E-value
Superfamily Immunoglobulin 1.28e-18
Family I set domains 0.0049
Further Details:      
 
Domain Number 12 Region: 3889-3978
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-18
Family I set domains 0.041
Further Details:      
 
Domain Number 13 Region: 4898-4991
Classification Level Classification E-value
Superfamily Immunoglobulin 1.68e-18
Family I set domains 0.0043
Further Details:      
 
Domain Number 14 Region: 2158-2251
Classification Level Classification E-value
Superfamily Immunoglobulin 2.66e-18
Family I set domains 0.017
Further Details:      
 
Domain Number 15 Region: 2282-2375
Classification Level Classification E-value
Superfamily Immunoglobulin 4.16e-18
Family I set domains 0.028
Further Details:      
 
Domain Number 16 Region: 5368-5467
Classification Level Classification E-value
Superfamily Immunoglobulin 1.27e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 17 Region: 2824-2910
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-17
Family I set domains 0.008
Further Details:      
 
Domain Number 18 Region: 1064-1161
Classification Level Classification E-value
Superfamily Immunoglobulin 3.82e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 19 Region: 1616-1712
Classification Level Classification E-value
Superfamily Immunoglobulin 4.66e-17
Family I set domains 0.017
Further Details:      
 
Domain Number 20 Region: 2471-2563
Classification Level Classification E-value
Superfamily Immunoglobulin 1.69e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 21 Region: 3098-3186
Classification Level Classification E-value
Superfamily Immunoglobulin 1.71e-16
Family I set domains 0.019
Further Details:      
 
Domain Number 22 Region: 3178-3270
Classification Level Classification E-value
Superfamily Immunoglobulin 1.89e-16
Family I set domains 0.041
Further Details:      
 
Domain Number 23 Region: 3794-3886
Classification Level Classification E-value
Superfamily Immunoglobulin 2.15e-16
Family I set domains 0.027
Further Details:      
 
Domain Number 24 Region: 1248-1345
Classification Level Classification E-value
Superfamily Immunoglobulin 2.97e-16
Family I set domains 0.015
Further Details:      
 
Domain Number 25 Region: 3971-4065
Classification Level Classification E-value
Superfamily Immunoglobulin 3e-16
Family I set domains 0.014
Further Details:      
 
Domain Number 26 Region: 1340-1436
Classification Level Classification E-value
Superfamily Immunoglobulin 3.41e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 27 Region: 3625-3715
Classification Level Classification E-value
Superfamily Immunoglobulin 3.84e-16
Family I set domains 0.024
Further Details:      
 
Domain Number 28 Region: 1156-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 4.28e-16
Family I set domains 0.021
Further Details:      
 
Domain Number 29 Region: 3536-3625
Classification Level Classification E-value
Superfamily Immunoglobulin 4.71e-16
Family I set domains 0.025
Further Details:      
 
Domain Number 30 Region: 880-977
Classification Level Classification E-value
Superfamily Immunoglobulin 9.45e-16
Family I set domains 0.011
Further Details:      
 
Domain Number 31 Region: 508-602
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000104
Family Fibronectin type III 0.00095
Further Details:      
 
Domain Number 32 Region: 1896-1982
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000121
Family I set domains 0.023
Further Details:      
 
Domain Number 33 Region: 1524-1621
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000022
Family I set domains 0.0095
Further Details:      
 
Domain Number 34 Region: 1807-1894
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000241
Family I set domains 0.045
Further Details:      
 
Domain Number 35 Region: 4066-4157
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000254
Family I set domains 0.012
Further Details:      
 
Domain Number 36 Region: 1433-1529
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000427
Family I set domains 0.013
Further Details:      
 
Domain Number 37 Region: 3272-3361
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000586
Family I set domains 0.018
Further Details:      
 
Domain Number 38 Region: 972-1067
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000105
Family I set domains 0.024
Further Details:      
 
Domain Number 39 Region: 325-413
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000117
Family I set domains 0.011
Further Details:      
 
Domain Number 40 Region: 3360-3446
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000013
Family I set domains 0.017
Further Details:      
 
Domain Number 41 Region: 3705-3798
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000288
Family I set domains 0.029
Further Details:      
 
Domain Number 42 Region: 3451-3537
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000374
Family I set domains 0.018
Further Details:      
 
Domain Number 43 Region: 2909-3001
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000619
Family I set domains 0.01
Further Details:      
 
Domain Number 44 Region: 807-887
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000141
Family I set domains 0.016
Further Details:      
 
Domain Number 45 Region: 1980-2073
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000148
Family I set domains 0.01
Further Details:      
 
Domain Number 46 Region: 1726-1794
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000079
Family I set domains 0.019
Further Details:      
 
Domain Number 47 Region: 3007-3097
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000904
Family I set domains 0.022
Further Details:      
 
Domain Number 48 Region: 4242-4337
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000462
Family I set domains 0.013
Further Details:      
 
Domain Number 49 Region: 703-780
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000939
Family I set domains 0.018
Further Details:      
 
Domain Number 50 Region: 2559-2649
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000293
Family I set domains 0.019
Further Details:      
 
Domain Number 51 Region: 2738-2832
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000331
Family I set domains 0.012
Further Details:      
 
Domain Number 52 Region: 4151-4246
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000358
Family I set domains 0.034
Further Details:      
 
Domain Number 53 Region: 4334-4428
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000059
Family I set domains 0.017
Further Details:      
 
Domain Number 54 Region: 425-502
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000455
Family I set domains 0.011
Further Details:      
 
Domain Number 55 Region: 2069-2162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000459
Family I set domains 0.011
Further Details:      
 
Domain Number 56 Region: 4433-4519
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000476
Family I set domains 0.0076
Further Details:      
 
Domain Number 57 Region: 4622-4694
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000604
Family I set domains 0.019
Further Details:      
 
Domain Number 58 Region: 5602-5664
Classification Level Classification E-value
Superfamily SH3-domain 0.000000352
Family SH3-domain 0.0048
Further Details:      
 
Domain Number 59 Region: 2381-2474
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000021
Family I set domains 0.016
Further Details:      
 
Domain Number 60 Region: 606-675
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000183
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000022201
Domain Number - Region: 2246-2290
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0971
Family I set domains 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000022201   Gene: ENSMMUG00000023096   Transcript: ENSMMUT00000023723
Sequence length 6629
Comment pep:known chromosome:MMUL_1:1:142026225:142170548:-1 gene:ENSMMUG00000023096 transcript:ENSMMUT00000023723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSQFSGAPRFLTRPKAFVVSVGKDATLSCQIVGNPTPQVSWEKDQQPVAAGARFRLAQ
DGDLYRLTILDLALGDSGQYVCRARNAIGEAFAAVGLQVDAEAACAEQAPHFLLRPTSIH
VREGSEATFRCRVGGSPKPAVSWSKDGRRLGEPDGPRVRVEELGEASALRIRAARPRDGG
TYEVRAENPLGAASAAAALVVDSDAADTASPPGTSTAALLAHLQRRREAMRVEGAPASPP
STGTRTCTVTEGKHARLSCYVTGEPKPETVWKKDGQLVTEGRRHVVYEDAQENFVLKILF
CKQSDRGLYTCTASNLVGQTYSSVLVVVREPAVPFKKRLQDLEVREKESATFLCEVPQPS
TEAAWFKEETRLWASAKYGIEEEGTERRLTVRNVSADDDAVYICETQEGSRTVAELAVQG
NLLRKLPRKTAVRVGDTAMFCVELAVPVGPVRWVRNQEEVVTGGRVAISAEGTRHTLTIS
QCCLEDVGQVVFMAGDCRTSTQFCVSAPRKPPLQPPVDPVVKAKTESSVILSWSPPPHGE
RPVTIDGYLVEKKKLGTYTWTRCHDAEWVATPELTVADVAEEGDFQFRVSALNSFGQSPY
LEFPGNVHLAPQLAVRTPLKAVQAVEGGEVTFSVDLTVASAGEWFLDGQALKTSSVFEIR
SDGTWHMLTIREVPASLHGAQLKFVANGIESSIRMEVRAAPGLTVHKPPAAAAREVLARL
HEEAQLLAELSDQAAAVTWLKDGRMLPPGPKYEVQASAGRRVLLVRDVAREDAGLYECVS
CGGRIAYQLSVQGLPCFLHKDMAGSCVDAVAGGPVQFECETSEAHVHVHWYKDGMELGRS
GERFLQEDVGTRHRLVAATVTRQDEGIYSCRVGEDSVDFRLRVSEPKVVFAKEQLAHRKL
QAEAGASATLSCKVAQAQTEVMWYKDGKKLSSSSKVRMEATGCTRKLVVQQAGQADAGEY
VCEAGGQRLSFHLDVKEPKVVFAKEQVAHSEVQAEAGARATLSCKVAQAQTEVTWYKDGK
KLSSSLKVHMEANGYRRRLVVQQVGKMDAGDYSCEARGQRVFFHLHITEPKMMFAKEQSV
HNEVWAEAGASAILSCEVAQAQMEVKWYKDGKKLSSSSKVRMEVKGCTRRLVVQQVGKAD
AGEYSCEAGGQRVSFQLHITEPKAVFAKEQSVHNEVQTEAGASATLSCEVAQAQTEVTWY
KDGKKLSSSSKVRVEASGCMRQLVVQQAVQADAGEYSCEAGDQRLSFHLDVSEPKAVFAK
EQLVHREVQAQAGASATLNCEVAQAQTEVMWYKDGKKLSSSSKVHVEAEGCTRRLVVQQA
GQADAGEYSCEAGGQRLSFRLHVAEPKAVFAKEQPVRREVQAELGTSATLSCEMAQAQTE
VTWYKDGKKLSSSPKVRMEAVGCTRRLVVQQVGQADAGEYSCEAGGQRLSFGLHVAEPKV
VFAKEQPAHRELRAEVGASATLSCEVAQAQTEVTWYKDRKKLSSSSKVRVEAVGCTRRLV
VQQVGQTEAGEYSCEAGGQRLSFRLHVTEPKVVFAKEQPAHREVQAEAGTSTMLSCEVAQ
AQTEVMWYKDRKKLSSSSKVRVEAVGCTRRLVVQEAGQADAGEYSCEAGGQRLSFHLHVA
EPKVVFAKEQPACRVVQAEAGASATLSCVVAQGQMEVTWYKDGKKLSSSSKVHVEAEGCT
RRLVVQQAGQADAGEYSCEAGGQWLSFHLHVAGPEPQISERPCRSEPLVVKEHEDIVLTA
TLATPSVATVTWLKDGVEIRRSKRHETASQGDTHTLTVHGAQVLDSAVYSCRVGAEGQDF
PVQVEEVAAKFCRPLKPVCGELGGTVTLACELSSACAEVVWRRGSTQLQVGKRFQMVAEG
PVRLLTVLELRAEDAGEYVCESRDDHTSAQLTVSVPRVVKFMSGLSAVVAEEGCEATFQC
VVSPSDAAVVWFRDGALLQPSEKFAISQSGTSHSLTISGLVLEDAGQITVEAEGVSSSAV
LRVREAPVLFKKKLEPQTVEERSSVTLEVELTRPWPELRWTRNAAALAPGKNVEIHAEGA
RHRLVLHNVGFADRGFFGCETPDDKTQAKLTVEMRQVRLIRGLQAVEAQEQGTATMEVQL
SHADVEGSWTRDGLRLQQGPTCHLAVRGPTHTLTLSGLRPEDSGLMVFKAEGVHTSALLV
VTELPVNFSRPLQDVVTTEKEKVTLECELSRPNVDVRWLKDGVELRAGKTVGIAAQGTCR
SLTIYRCEFADQGMYVCDAHDAQSSASVKVQGRTYTLIYRRVLAEDAGEIKFVAENAESR
AQLRVKELPVTLVRPLRDKIAMEKHRGVLECQVSRASAQVRWFKGSQELWPGPKYELVSD
GLYRKLIISDVQAEDEDTYTCDAGDVKTSAQFFVEEQSITIVRGLQDVTVMEPAPAWFEC
ETSIPSVRPPKWLLGKTVLQAGGNVGLEQEGTVHRLMLRRTCSTMTGPVHFTIGKSRSSA
RLVVSDIPVVLTRPLEPKTGRELQSVVLSCDFRPAPKAVQWYKDDTPLSASEKFKMSLEG
QMAELRILRLMPADAGVYRCQAGSAHSSTEVTVEAREVTVTGPLQDAEAMEEGRASFSCE
LSHEDEEVEWSLNGMPLYNDSFHEISHRGRCHTLVLKSVRRADAGTVCASSPKVSTSAHL
EVRVKPVVFLKGLDDLSAEEHGTLALQCEVSDPEAHVVWRKDGVQLGPSDKYDFLHTAGT
RGLVVHDLSPEDAGLYTCHVGSEETQARVSVHDLHVGITKRLKTVEVLEGESCSFECVLS
HESASDPAMWTVGGKTVGSSSRFQATRQGRKYILVVREAVPSDAGEVVFSVRSLTSKASL
IVKERPATIMKPLEDQRVAPGEDVELRCELSRAGTPVRWLKNGKAIRKSQKYDVVCEGTM
AVLVIRGASLKDVGEYTCEVEASKSTASLCVEEKANCFTEELTNLQVEEKGTAVFTCKTE
RPAATVTWRKGLLELRASRKHQPSQDGLALQLTISALEKADSDIYTCDIGQAQSQAQLLV
QGRRVHIIEDLEDVDVQEGSSATFRCRISPANYEPVHWFLDKTPLHANELNEIEAQPGGY
HVLTLRQLALKDSGTIYFEAGDQRASAALRVTGKPSVFSRELTDATITEGEDLTLVCETS
ACDSPVCWTKDGKTLRGSARYQLSHEGHRAQLLITGATLQDSGRYKCETGGACSSSIVRV
HARPVRFQEALKDLEVREGGAATLRCVLSSVAAPVEWRCGDNVLRPGDKYSLRQEGAVLE
LVVRNLRPQDSGRYSCSFGDQTTSATLTVTALPAQFIGKLRNKEATEGATATLRCELSKA
APVEWRKGSETIRDGDRYCLRQDGAMCELQIRGLAMVDAGEYSCVCGEERTSASLTIRAM
PAHFIGRLRHQESTEGATATLRCELSKVAPVEWRKGRESLRDGDRHRLRQDGAVCELQIC
GLAVADAGEYSCVCGEERTSATLTVKALLAKFTEGLRNEEAVEGATAMLWCELSKVAPVE
WRKGPKNLRDGDRYILRQEGTRCELQICGLAMADAGEYLCVCGQERTSATLTIRALPARF
IEDVKNQEAREGTTVMLQCELNNAAPVEWRKGSETLRDGDRYSLRQDGTKCELQIRGLSM
VDTGEYSCVCGQERTSAMLTVRALPIKFTEGLRNEEATEGATATLWCELSKVAPVEWWKG
HETLRDGDRHSLMQDGARCELQIRGLVAEDAGEYLCMCGKERTSAMLTVRALPSKFIEGL
RNEEATEGATAILWCELSKVAPVEWRKGHDCLRDGDRHSLKQDGSRCELQIRGLAVVDAG
EYSCVCGQERTSAILTVRALPARFIEDVKNQEAREGATAVLQCELSKADPVEWRKGSETL
RDGDRYSLRQDGTRCELQIRGLSVADTGEYSCVCGQERTSATLTIRAPQPVFREPLQSLQ
AEEGSTATLQCELSEPTATVVWSKGGLQLRANGRREPRLQGCTAELVLRGLRREDTGEYT
CTCGSQATSATLTVTAAPVRFLQELQPQEVDEGGTAHLRCELSRAGASVEWRKGSLELFP
CAKYQMVQDGAAAELLVHGVEQEDAGDYTCDTGHTHSMASLSVRVPRPKFETRLQSLEQE
TGDIARLCCQLSDAESGATVQWLKEGVELHAGPKYEMRSQGAMRELLIHQLEAKDTGEYA
CVTGGQKTTASLRVTEPEVTIVRGLVDAEVLANEGVEFSCEVSRAGATGMQWCLQGLPLQ
SNEVTEVTVQDGRIHTLRLKGVTPEDAGTVSFHLGNCASSAQLTIRAPEVTILEPLQDVQ
LSEGQDASFQCRLSRASGQEACWALGGVPLQDNEMNDITVEQGTLHLLTLHKVTLEDAGT
VSFHVGTCSSEAQLKVTAKNTVVRGLENVEALEGGEALFECQLSQPEVAAHTWLLDDEPV
RTSENAEVVYFENGLRHLLLLKNLRPQDSCRVTFLAGDMVTSAFLTVRGWRLEILEPLKN
AVVRAGAQALFTCTLSEVVPVGEASWYINGAAVQPDDADWTVTADGSHHALLLRSAQLLH
AGEVTFACRDAVASARLTVLGLPDPPEDAEVVACSSHTVTLSWAAPMSDGGGGLCGYRVE
VKEGAMGQWRLCHELVPGPECVVDGLAPGETYRFRVAAVGPVGAGEPVHLPQTVRLATPP
KPVPPQPSAPESRQVAAGEDVCLVLEVAAEAGEVIWHKGKERIQPSGRFEVSQGRQQMLV
IRGFTAEDQGEYHCGPAQGSTCPAAATFQVALSPASVDEAPPQPSLPLEAAQEGDLHQLW
EALARKRRMSREPTLESISELPEEDGRSLQLPQEAEEVAPDLSEGYSTADELARTGEADL
SHTSSDDESRAGTPSLVTYLKKAGRQGTSPLTSKVGAPAAPSVKPQQQQEPLAAVRPPLG
DLSTKDLGDPSMDKAAVKIQAAFKGYKVRKEMKQQEGPMFSHTFGDTEAQVGDALRLECV
VASKADVRACWLKDGVELTDGRHHHIDQLGDGTCSLLITGLGHADAGHYTCQVSNKFGQV
AHSACVVVSGTESEAESSSGGELDDAFRRAARRLHRLFRTKSPAEVSDEELFLSADEGPA
EPEEPADWQTYHEDEHFICIRFEALTEARQAVTRFQEMFATLGIGVQINLVEEGPRRVEM
RISKEAPAPVVPPEPLPSLLTSDAAPVFLTELQNQEVQDGYPVSFDCVVRGQPMPSVRWF
KDGKLLEEDDHYMINEDQQGGHQLIITAVVPADMGVYRCLAENSVGVSSTKAELRVDLTS
TDYDTAADATETSSYFSAQGYLSSREQEGTESTTDEGQLPQVVEELRDLQVAPGTRLAKF
QLKVKGYPAPRLYWFKDGQPLTASAHIHMTDKKTLHTLEIISVTREDSGQYAAYISNAMG
AAYSSARLLVRGPDEPEEKPASDVHEQLVPPRMLERFTPKKVKKGSSITFSVKVEGRPAP
TVHWLREEAERGVLWIGPDTPGYTMASSAQQHSLVLLDVGRQHQGTYTCIASNAAGQALC
SASLRVSGLSKVEEQEKVKEALISTFLQGTTQAVSAQGLETASFADLGGQRKGEPLAAKE
ALRHLSLAEVGTEEFLQKLTSQITEMVSAKITQAKLQVPGGDSDDDSKTPSASPRHGRSR
PSSSIQESSSESEDGDARGEIFDIYVVTADYLPLGAEQDAIALREGQYVEVLDAAHPLRW
LVRTKPTKSSPSRQGWVSPAYLDRRLKLSPEWGAAEAPEFPGEAVSEDEYKSRLSSVIQE
LLSSEQAFVEELQFLQSHHLQHLERCPHVPAAVASQKAVIFRNVRDIGLFHSSFLQELQQ
CDTDDDVAMCFIKNQAAFEQYLEFLVGRVQAESVVVSTAIQEFYKKYAEEALSAGDPSQP
PPPPLQHYLEQPVERVQRYQGLLKELIRNKARNRQNCALLEQAYAVVSALPQRAENKLHV
SLMEKYPGTLEALGEPIRQGHFIVWEGAPGARMPWKGHNRHVFLFRNHLVICKPRRDSRT
DTFSYVFRNMMKLSSIDLNDQVEGDDRAFEVWQEREDSVRKYLLQARTAIIKNSWVKEIC
GIQQRLALPVWRPPDFEEELADCTAELGETVKLACRVTGTPKPVISWYKDGKPVQVDPHH
ILIEDPDGSCALILDSLTSVDSGQYMCFAASAAGNCSTLGKILVQVPPRFMNQVRASPFV
EGEDAQFTCTIEGAPYPQIRWYKDGALLTPGSKFQTLSEPRSGLLVLVIRAAGKEDLGLY
ECELVNRLGSTRASAELHIQSPTLQAREQCHREQLAGAVEVTEQETKVPKKTVIIEETIT
TVVKSPRGQRRSPSKSPSRSPSRCSVSLLRPGLLAPDLLYLPGAGQPRRPEAEPGRKPVV
PTLYVTEAEAHSPALPRLSGSQPKWVEVEETIEVQVKKMGPQGVSPARDVPRSSSGHLFT
LPGATPGGDPNSNNSNNKLLAQEAWAQGTAMVSIREPLVFHVDARGSVDWAASDVGSLEL
EETGVTLEEECTMEEAGEEEGEDGDAFVTEESQDTHSLGDRDPKILTHNGRVLTLADLED
YVPGEGETFRCGGPGPGAPDDPPCEVSVIQREIGEPTVGQPVLLSVGHALGPRGPLGLFR
PELRGASPPGPQVRSLEATSFLLPEAPARPVGSAPWTQSFCTRIRRSVDSGQSSFTTELS
TQTINFGTVGETVTLHICPDKDGDEGAQP
Download sequence
Identical sequences 9544.ENSMMUP00000022201 ENSMMUP00000022201 ENSMMUP00000022201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]